(data stored in SCRATCH3701 zone)

EMBL: CP000435.PILC

CP000435.PILC        Location/Qualifiers
FT   CDS_pept        complement(24218..25498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="sync_0019"
FT                   /product="type IV pilus assembly protein PilC"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47546"
FT                   /db_xref="GOA:Q0IE64"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE64"
FT                   /protein_id="ABI47546.1"
FT                   /translation="MVSFTATYTSATGQPRTVTVKANDAVSARRLLRRRGIKADELRQD
FT                   TSKRKGKEKFQAESKGAGGSSSAGWLSMDLGEAFQKPPGVKEKAIWASKLAALVDAGVP
FT                   IVRSLDLMATQQKLPMFKKALTSVGLEVNQGTAMAAAMRQWPKVFDQLTIAMVEAGEAG
FT                   GVLDESLKRLAKLLEDNARLQNQIKGALGYPVAVLVIAILVFLGMTIFLIPTFAGIFED
FT                   LGAELPLFTQLMVDLSALLRSSASVVFAGILMIGAWLIGRYYNTHKGRRVLDKLILKLP
FT                   LFGDLIMKTATAQFCRIFSSLTRAGVPILMSMEISSETAGNSIISDAILDSRTLVQEGV
FT                   LLSTALTRQKVLPDMALSMLSIGEETGEMDRMLSKVADFYEDEVSTSVKALTSMLEPAM
FT                   IVVVGGIVGSILLAMYLPMFTVFDQIQ"
     atggtctctt tcaccgccac ttacacctca gctacaggcc aaccgcgaac ggtcacggtc        60
     aaagcaaacg atgctgtttc ggcccgtcgt ctgctacgga ggcgcggaat taaagcggat       120
     gagcttcgcc aagacacaag caagcgaaaa ggaaaagaga aattccaggc cgaatccaaa       180
     ggagcaggtg gaagctcatc agcagggtgg ctgtcgatgg atctgggaga agctttccag       240
     aaaccacctg gggtgaaaga gaaagccatt tgggccagca agctggccgc gctcgtggat       300
     gcaggggtcc caattgtgcg cagccttgat ctcatggcca cgcagcaaaa attgccgatg       360
     tttaaaaaag ctctcaccag cgtgggactc gaggtaaatc agggcacggc aatggcagca       420
     gcaatgcgcc aatggcccaa ggtctttgac caactcacca tcgccatggt ggaggcaggc       480
     gaagccggcg gtgttctgga tgaatccctc aaacgcctcg ccaagttgtt ggaagacaac       540
     gcgagactcc aaaaccaaat caaaggtgcc ctgggttacc ccgtagcagt gctggtgatc       600
     gccattttgg tgtttttagg aatgacaatc tttttgattc ccactttcgc cggaatcttt       660
     gaagatctag gagccgaatt accgttattt acgcaattaa tggtggattt aagcgcctta       720
     ctccgctcct ccgcctcagt cgtgttcgct ggaattctaa tgattggcgc ctggttaatc       780
     ggccgttatt acaacaccca caaaggccgc agagttctcg acaaattaat cctcaagctg       840
     ccgttgtttg gtgatctcat catgaaaact gccacggctc aattttgccg aatcttcagc       900
     tcactcacgc gcgctggtgt tccaatcctg atgtccatgg agatctccag tgaaacagct       960
     ggcaactcga tcatctctga cgcgattctg gactcacgca ccctggtaca ggaaggcgtg      1020
     ttgctcagca cagccttgac ccgccaaaag gttttgcctg acatggcgct gagcatgctc      1080
     tccattgggg aggaaacggg agaaatggat cgaatgctga gcaaagttgc cgacttttat      1140
     gaagacgaag tctcaacctc ggtaaaggca ctcacctcga tgctggagcc cgcgatgatt      1200
     gtggtggtgg gaggaattgt gggttcgatc cttttagcga tgtacctacc gatgtttacg      1260
     gtgtttgatc agattcagta g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page