(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSAA

CP000435.PSAA        Location/Qualifiers
FT   CDS_pept        402563..404866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaA"
FT                   /locus_tag="sync_0393"
FT                   /product="photosystem I core protein PsaA"
FT                   /note="identified by match to protein family HMM PF00223;
FT                   match to protein family HMM TIGR01335"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47329"
FT                   /db_xref="GOA:Q0ID48"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006243"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID48"
FT                   /protein_id="ABI47329.1"
FT                   /translation="MTISPPERGSTAKSQVEKVDNPATFELFGKPGHFDRALAKGPKTT
FT                   TWVWNLHANAHDFDSHTSDLEEVSRKIFSAHFGHLAVIFIWLSGAFFHGARFSNFSGWL
FT                   ADPTHVKPSAQVVWPVFGQEILNGDMGAGFQGIQITSGLFHVWRAWGITNETQLMSLAI
FT                   GALVMAGLMLNAGVFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWTGHLLHVSLP
FT                   TTKLMDAIDAGQPLVLNGKTIASVADIPLPHEFFNQDLIAQLYPGFGAGIGAFFSGDWA
FT                   AYSDFLTFKGGINPVTGSMWMSDIAHHHLAIAVLFIVAGHMYRTNWGIGHSIKEILEGQ
FT                   KGDPLLFPATKGHDGLFEFMTTSWHAQLGVNLAMLGSLSIIVAQHMYAMPPYPYMAIDY
FT                   PTQIGLFTHHMWIGGFLIVGAAAHAAIAMIRDYDPAKHVDNVLDRVLKARDAIISHLNW
FT                   VCIWLGAHSFGLYVHNDTMRALGRPQDMFSDSAISIQPVFAQWIQGIHAGAAGSTAPNA
FT                   LAGVSEVFNGSTIAVGGKVAAAAIPLGTADFMVHHIHAFTIHVTVLILLKGVLYARSSR
FT                   LVPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSVVIFHFSWKMQSDVWG
FT                   TVNADGSVQHITNGNFANSAITINGWLRDFLWAQAAQVINSYGSNTSAYGLMFLGAHFV
FT                   WAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIA
FT                   TTWAFFHAHILVVG"
     atgaccatta gcccaccaga gcgtgggagc accgcgaaga gccaagtcga aaaggttgac        60
     aatccagcaa cctttgaatt gttcggcaag cccggacatt tcgaccgagc tctcgcgaaa       120
     ggccccaaga ccacaacctg ggtctggaac ctccacgcca acgctcacga tttcgatagt       180
     cacacgagtg accttgaaga ggtttctcgg aagatcttta gtgctcactt cggccatttg       240
     gccgtgatct tcatctggct aagcggcgcc ttcttccacg gagcccgctt ctccaacttc       300
     tccggctggc tcgccgatcc cacccacgtg aagccaagtg ctcaggtggt gtggcccgtg       360
     tttggccagg agattctcaa tggcgacatg ggtgccggat tccaaggcat ccagatcacc       420
     tctggcctct ttcacgtctg gcgtgcatgg ggaatcacca atgagaccca gctgatgtcg       480
     cttgccatcg gcgctctggt gatggcaggc ctgatgctca atgccggtgt tttccactat       540
     cacaaggcag ctcccaagct cgagtggttc cagaacgttg agtccatgct caaccaccac       600
     ttggcaggtt tgcttggtct cggctcactc tcttggaccg gccaccttct gcatgtgtct       660
     ctgccgacta ccaagttgat ggatgccatc gacgccggcc aaccgctggt gctcaatggc       720
     aaaaccatcg cttctgtcgc agacattcca ctgccacacg aattctttaa tcaggatttg       780
     atcgctcagc tctatccagg atttggtgcc ggtattggtg cctttttctc tggtgattgg       840
     gctgcctaca gcgacttcct gacctttaaa ggtggaatta atccagtcac cggcagcatg       900
     tggatgagcg atatcgctca tcaccactta gccatcgcgg tgttgttcat cgtggctggt       960
     cacatgtacc gcacgaactg gggcattggg cactccatca aggagatcct cgaaggtcag      1020
     aagggtgatc ctcttctctt ccctgcaacc aaggggcacg acggactctt tgagttcatg      1080
     actacctctt ggcatgctca gttgggcgtc aatctggcca tgctcggctc tctgagcatc      1140
     atcgtggccc agcacatgta tgcgatgcct ccgtatccat acatggcgat tgactacccc      1200
     actcagattg gactgttcac ccatcacatg tggatcggtg gcttcctaat cgttggcgct      1260
     gctgctcacg cagccatcgc catgattcgc gattacgacc ctgcaaaaca tgtggacaac      1320
     gtgctcgatc gtgtgctcaa agcgcgcgat gcgatcatca gccacctgaa ctgggtttgc      1380
     atttggcttg gagctcatag cttcggcctt tatgtccaca acgacacgat gcgtgctctg      1440
     ggtcgtcccc aagacatgtt cagcgattcg gcgatttcga ttcagccggt ctttgcgcag      1500
     tggattcagg gcatccatgc aggagccgca ggaagcaccg ctcccaacgc acttgctggt      1560
     gtgagtgagg tgtttaacgg ctccacgatt gctgttggag gcaaggttgc agcagcagcg      1620
     attcctctcg gaaccgctga tttcatggtg caccacattc acgcattcac aattcatgtg      1680
     actgtgctga ttcttctgaa gggcgtgctt tatgcccgca gctcccgcct cgttccagac      1740
     aaagcaaact tgggcttccg tttcccatgc gacggcccag gccgtggtgg cacctgtcag      1800
     gtgtctgctt gggaccacgt attccttggt ctgttctgga tgtacaactc cctgtccgtc      1860
     gtgatcttcc acttcagctg gaagatgcag agcgatgttt ggggaaccgt caatgctgat      1920
     ggaagtgttc agcacatcac aaatggcaat tttgccaaca gtgcaatcac catcaacggc      1980
     tggctgcgtg acttcctgtg ggcccaggcc gctcaggtga tcaacagcta tggctcaaac      2040
     accagtgcct atggcctgat gttccttggt gctcactttg tctgggcctt cagtttgatg      2100
     ttcttgttta gtggccgcgg ctactggcaa gagcttattg agtccattgt ttgggctcat      2160
     aacaagctga aggttgcacc tgccatccag cctcgtgcac tttcaatcac ccagggccgt      2220
     gccgtgggtg tcgctcatta cctcttgggc ggcatcgcga ccacatgggc cttcttccac      2280
     gcccacatcc ttgtggtcgg ctga                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page