(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSAC

CP000435.PSAC        Location/Qualifiers
FT   CDS_pept        140569..140814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaC"
FT                   /locus_tag="sync_0133"
FT                   /product="photosystem I iron-sulfur protein PsaC"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR03048"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47876"
FT                   /db_xref="GOA:Q0IDV2"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDV2"
FT                   /protein_id="ABI47876.1"
FT                   /translation="MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRT
FT                   EDCVGCKRCETACPTDFLSIRVYLGDETSRSMGLSY"
     atgtcccacg ccgtcaagat ctacgacacc tgcatcggtt gcacacaatg tgtgcgtgct        60
     tgccccctag acgtcctcga aatggtccct tgggacggct gcaaggcggg ccaaatcgcc       120
     tcctctcctc gtacagagga ttgtgtgggc tgcaagcgct gcgaaaccgc ctgccccaca       180
     gacttcctca gtattcgtgt ctatctcggg gacgagacca gtcgaagcat gggcttgtcc       240
     tactga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page