(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSAD

CP000435.PSAD        Location/Qualifiers
FT   CDS_pept        complement(460962..461393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaD"
FT                   /locus_tag="sync_0463"
FT                   /product="photosystem I reaction center subunit II"
FT                   /note="identified by match to protein family HMM PF02531"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46131"
FT                   /db_xref="GOA:Q0ICY1"
FT                   /db_xref="InterPro:IPR003685"
FT                   /db_xref="InterPro:IPR036579"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY1"
FT                   /protein_id="ABI46131.1"
FT                   /translation="MTASALTGQLPQYIGSTGGLLNSAETEEKYAITWTSKSEQAFELP
FT                   TGGAAMMSSGENIMYFARKEQCLALGTQLRTKFKPRIEDFKIYRIFPGGDTEFLHPLDG
FT                   VFPEKVNEGRPMVGHNPRRIGANTNPANIKFSGRNTYDS"
     atgacagcat ccgccttaac cggtcagctc ccccagtaca tcggcagcac cggcggcctg        60
     ctcaattccg ctgaaacgga agagaagtac gccatcacct ggaccagcaa gagcgagcaa       120
     gcctttgaac tccccacagg tggagccgca atgatgtctt ctggcgaaaa catcatgtat       180
     ttcgctcgca aagaacagtg cttggccttg ggcactcaac tccgcaccaa attcaagcct       240
     cggatcgagg acttcaagat ctatcggatc ttccctggtg gcgataccga gtttctccat       300
     ccactggatg gcgtcttccc cgagaaagtg aacgagggac ggccgatggt tggacacaac       360
     cccaggagaa tcggtgcgaa caccaatcct gcaaatatca agttcagcgg tcgcaataca       420
     tacgactcct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page