(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBB

CP000435.PSBB        Location/Qualifiers
FT   CDS_pept        complement(515002..516564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="sync_0534"
FT                   /product="photosystem II P680 chlorophyll A apoprotein"
FT                   /note="identified by match to protein family HMM PF00421;
FT                   match to protein family HMM TIGR03039"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45633"
FT                   /db_xref="GOA:Q0ICR2"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR2"
FT                   /protein_id="ABI45633.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALVAGWAGSMALYELAIF
FT                   DPSDPVLNPMWRQGMFVMPFMSRLGVTGSWGGWSITGETGVDPGFWSFEGVAAAHIVFS
FT                   GLLMLAAIWHWTYWDLEIWQDPRTGEPALDLPKIFGIHLLLAGLGCFGFGAFHLTGVFG
FT                   PGMWISDPYSLTGHLEAVQPSWGPEGFNPFNPGGIVAHHIAAGIVGIIAGIFHITTRPP
FT                   ERLYKALRMGNIETVLASAIAAVFFAAFIVAGTMWYGAAATPVELFGPTRYQWDQSYFK
FT                   TEINRRVQTALDEGASIDEAYAAIPEKLAFYDYVGNSPAKGGLFRVGPMVNGDGLATGW
FT                   IGHPVFTDKEGRELQVRRLPNFFENFPVVLEDNDGIVRADIPFRRAEAKYSFEQKGVTA
FT                   TVYGGSLDGKVFTDPADVKRLARKAQLGEGFEFDRETYNSDGTFRSSPRGWFTFGHATF
FT                   ALLFFFGHIWHGARTLYRDVFAGIDPDLGEQVEFGLFQKLGDKSTRRLPEGYVPPTGST
FT                   PLS"
     atgggattgc cctggtatcg ggtgcacacc gtcgtcatta acgaccccgg ccgactcctg        60
     gccgtgcacc tcatgcacac tgccctcgtt gccggctggg ccggctcgat ggccctctac       120
     gaactagcaa tttttgatcc atcggatcca gtcctgaacc ccatgtggcg ccagggcatg       180
     tttgtcatgc ccttcatgtc gcgacttggc gttaccggaa gctggggagg ttggagtatc       240
     accggagaaa cgggagtcga tcctggcttc tggagtttcg aaggcgttgc agccgctcat       300
     atcgtcttca gcggtctctt gatgcttgct gcgatttggc actggacgta ttgggatctt       360
     gaaatttggc aagatccccg tacgggcgaa ccagctcttg accttccgaa aattttcggc       420
     atccaccttc tcctcgcagg acttggctgt tttggatttg gtgcctttca cctcacaggt       480
     gtcttcggac ctggaatgtg gatctctgat ccgtattcat taacgggtca cttagaagcg       540
     gttcaaccat cgtgggggcc agaaggcttc aacccgttta acccaggcgg gattgtggcc       600
     caccacattg ccgcaggcat cgtgggaatc attgccggta ttttccacat cacaacgcga       660
     ccgccggagc gcctctacaa ggccttacgg atgggaaata ttgagactgt gcttgccagc       720
     gctatcgcag ctgtgttctt cgctgccttc atcgtggctg gaaccatgtg gtacggcgcc       780
     gctgccactc ctgtcgaact gtttggcccc actcgttatc agtgggatca gagttacttc       840
     aagacagaaa tcaatcgccg cgttcaaacg gcccttgacg aaggcgcctc cattgatgag       900
     gcctacgcag ccatacccga aaaactggct ttctacgact atgtcggcaa cagtcctgcc       960
     aaaggcggcc tgttccgtgt tggtccgatg gtgaatggag acggtctcgc caccggatgg      1020
     attggtcatc ctgtcttcac cgacaaagaa ggacgtgaac ttcaagtgcg tcgtcttccc      1080
     aacttcttcg agaacttccc agttgttctt gaagacaacg acggcatcgt tcgcgcagac      1140
     attccgttcc gtcgtgccga agccaagtat tccttcgaac agaagggagt tacagcaacc      1200
     gtttatggcg gttctctcga tggcaaggtc ttcactgatc ctgctgacgt gaaacgcctg      1260
     gcccgtaagg cccaactcgg tgaaggtttt gaattcgatc gcgaaaccta taactcggac      1320
     ggaacgttcc gcagttcacc acgcggctgg ttcacgttcg ggcacgcaac tttcgccctg      1380
     ctcttcttct tcggccacat ctggcacggt gctcgcaccc tctaccgtga cgtgttcgca      1440
     ggaatcgacc cagatcttgg cgaacaggtt gaattcggcc tcttccaaaa acttggcgac      1500
     aaatccaccc gtcgcctacc cgagggatat gttcctccca cgggatccac acccctcagc      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page