(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBN

CP000435.PSBN        Location/Qualifiers
FT   CDS_pept        complement(321816..321956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbN"
FT                   /locus_tag="sync_0309"
FT                   /product="photosystem II reaction center protein PsbN"
FT                   /note="identified by match to protein family HMM PF02468"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45290"
FT                   /db_xref="GOA:Q0IDC9"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDC9"
FT                   /protein_id="ABI45290.1"
FT                   /translation="MESSSPAMSVAIAVLAALLGLTGFGVYTAFGPPSKNLDDPFDDHE
FT                   D"
     atggaaagtt cgtccccagc catgtcagtg gcgattgccg tgctggcggc cctgcttggg        60
     ttaacaggat ttggggtgta cacagccttt gggcctccat caaaaaatct cgacgacccg       120
     ttcgatgatc acgaagattg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page