(data stored in SCRATCH3701 zone)

EMBL: CP000435.PSBZ

CP000435.PSBZ        Location/Qualifiers
FT   CDS_pept        86371..86559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbZ"
FT                   /locus_tag="sync_0080"
FT                   /product="photosystem II core protein PsbZ"
FT                   /note="identified by match to protein family HMM TIGR03043"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45691"
FT                   /db_xref="GOA:Q0IE04"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE04"
FT                   /protein_id="ABI45691.1"
FT                   /translation="MQILNTLTVLALVVMSFALIVAVPVLYASNEDSGRSNRLILLGGI
FT                   AWVALVLLNWGVSYFVV"
     atgcagatcc tcaacaccct caccgtgctg gccctggtgg tgatgtcgtt tgccctcatc        60
     gtggcggttc ctgtgctgta cgcctcgaat gaggacagcg gacgttccaa ccgcttgatc       120
     ctgctgggtg ggatcgcctg ggtggccctg gtattgctca actggggcgt gagctacttc       180
     gtggtctga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page