(data stored in SCRATCH3701 zone)

EMBL: CP000435.PYRE

CP000435.PYRE        Location/Qualifiers
FT   CDS_pept        complement(287284..287853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="sync_0276"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45906"
FT                   /db_xref="GOA:Q0IDG0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG0"
FT                   /protein_id="ABI45906.1"
FT                   /translation="MSQRFEHDPLLERLAKEAYRHGNFTLASGRSSHHYVNCKPVSLSG
FT                   SGLALLCPAMLALVETDAAAVGGLTLGADPLVSGVALAAAQRGRSLNALIVRKQAKGHG
FT                   TGAWLEGPLPEQGALVTVLEDVVTTGGSSIKAVEQLRAAGYIVNRVVTIVDREEGGAAA
FT                   MQAAGLELHSLYRLEEVAAQSRELQA"
     atgtctcaac gttttgaaca cgaccccctg ctggaacgcc tagcgaaaga ggcttaccgc        60
     catggcaact tcaccctcgc gtccggtcgc agcagccatc actacgtgaa ttgcaagcct       120
     gtcagcttga gcggctcagg cctagccctg ctctgcccag cgatgctggc tctggttgaa       180
     acggatgcgg cagccgttgg cggcctcacc ctgggagccg atccgctcgt gagtggtgtc       240
     gcccttgctg ccgctcagcg aggacgctct ctgaatgctc tgatcgtgcg taagcaggcc       300
     aaaggccacg gcacaggggc ctggctggaa ggtccactgc cagagcaggg cgcgctcgtc       360
     accgttcttg aggatgtggt caccaccggt ggatcatcca tcaaagctgt tgaacaactc       420
     cgagccgctg gctacatcgt gaatcgggtg gtgacgattg ttgaccgtga agagggaggg       480
     gctgctgcga tgcaagccgc tggcctcgag ttacacagcc tgtatcgcct ggaagaggtg       540
     gccgcccagt ccagagagct ccaagcatga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page