(data stored in SCRATCH3701 zone)

EMBL: CP000435.RECO

CP000435.RECO        Location/Qualifiers
FT   CDS_pept        complement(573276..574091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="sync_0604"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47376"
FT                   /db_xref="GOA:Q0ICK0"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICK0"
FT                   /protein_id="ABI47376.1"
FT                   /translation="MSPERRIEGLALKVGPLGEHDRLLTLLSDDVGLIRLAVPGARKPR
FT                   SSLAAAVPLTTMELQVGGRSGLLRVRQLRVQHNFGNVGQRLETLAAAQALSELSISLVA
FT                   GDDPVPGMLSAVLMHLERLELLAQKQRSSEMKSAEGERVDRTLATLVQACVHLLALGGY
FT                   GLPLQTCCRSGAALSPPIGNWEWRCSLLADEGLAIGSQAGAAIQINPSELALLQRLTRL
FT                   ELPERQDGGLMGPRPVWLRLFTLLESWCRVHLPRPVRSFAMVREAVANA"
     atgagcccgg aacggcgaat cgaagggttg gcgttaaagg tgggccccct cggggagcac        60
     gacagactgc tcaccttgct cagtgatgac gttggcctga ttcgcctggc cgtgccaggg       120
     gcacgcaaac cccgcagcag cctggcggcg gcggtgcctc tcaccaccat ggagctgcag       180
     gtgggaggac gcagcgggct gctgcgggtg cgccaacttc gggttcaaca caatttcggc       240
     aacgtggggc agagattgga aacattggca gccgcccagg ccctatctga gctctcgatc       300
     tcgttggtcg ctggcgatga tccagtaccc ggaatgctta gtgcggtttt gatgcatctt       360
     gagcggctcg agctgctggc gcagaaacag cgttcgtctg aaatgaaaag tgcggaaggg       420
     gagcgtgtcg atcgaaccct ggcaacgctt gttcaggcct gtgttcatct gctcgctctc       480
     ggcggctacg gcctgcctct ccaaacgtgt tgccgcagtg gagccgccct gtctccaccg       540
     atcgggaatt gggaatggcg ttgcagcctg ctggccgacg aagggctggc catcggttct       600
     caagctggag cggctatcca gatcaacccc tccgaactcg ccctgctcca gcgattaaca       660
     cggcttgaac tgccggaacg tcaagacggt ggattgatgg ggccccgacc cgtttggctc       720
     aggcttttta cacttttgga gagctggtgt cgcgtgcatc tcccaaggcc cgtccgctca       780
     tttgccatgg tgagagaggc tgtcgctaac gcttaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page