(data stored in SCRATCH3701 zone)

EMBL: CP000435.RECQ

CP000435.RECQ        Location/Qualifiers
FT   CDS_pept        539398..540888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="sync_0564"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P15043; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM TIGR00614; match to
FT                   protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46197"
FT                   /db_xref="GOA:Q0ICN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN8"
FT                   /protein_id="ABI46197.1"
FT                   /translation="MDSLLEALHRHYGWDSFRSGQRPVIEALLSGRDCLAVLPTGGGKS
FT                   LCFQLPALVRQGLVVVISPLVALMDDQVLQLQRRGIAAACLHRGIQPEQRRLIQTQLSA
FT                   GSLRLLYLAPERLQGEAARDMLSAYARDGRLVALAVDEAHCISAWGHDFRPDYRRLGQL
FT                   RALCPGVPLVALSATAAPRVRADILRLLGLCKPLIQVSSAQRTNLKYTMRRRPSDPLPD
FT                   VLEALQDSRGATLIYARTRRSVELWAERLQAQGIPAITYHAGLEPERREEALMHFLEAD
FT                   APVLVATVAFGMGVDRPDVGLVLHLDLPATPEGYLQESGRAGRDGRPAHCLVLFSPGDR
FT                   TSLGWAMQSTLRRASESKVSDDDVWRVEFSQQQLRRMEAVAEGEICREQALLLSVGELT
FT                   SPCGRCDRCLAQVRPKDWSDRAQELLEVIDAGQGADIRSLTERLRELDGSEERWGWLAR
FT                   RLVQEELIRESNDGAQRLSLRDSGRQFLHAPWPLHYAA"
     ttggattcac tccttgaggc tctccacagg cattacggct gggactcctt tcgttcagga        60
     caacgtcctg tcatcgaagc actgctgagc ggtcgcgact gcttagcagt gctgccaacc       120
     ggaggcggaa aatcgctttg ttttcagctt cctgccttgg tgcggcaggg gctggtcgtg       180
     gtgatatctc cactcgttgc tctgatggat gatcaggttt tgcaactgca gcggaggggg       240
     attgctgctg cctgcctgca ccgcgggatt caacctgaac aacgacgttt gattcagaca       300
     cagttatcgg ctggcagctt gcgtctcctt tatctcgccc ctgagcgtct tcaaggtgag       360
     gcggcgaggg acatgctctc tgcctatgca agggatgggc ggctggtggc attggccgtg       420
     gatgaggctc attgcatcag cgcttggggg catgattttc ggcccgacta caggcgcctt       480
     ggtcagcttc gcgccctttg ccccggtgtc ccgctcgttg cgttgagtgc aaccgcagct       540
     ccaagggtgc gggctgacat cctccgtcta cttgggttat gtaaaccgct catccaggtg       600
     tcgtcggcgc aacgcaccaa cctcaaatac acaatgcggc gccgtccgag cgatccgctc       660
     cctgatgtct tagaggccct gcaggattca cggggtgcca ccttgatcta tgccaggacc       720
     cgtcgttcgg tggagctctg ggctgaacgg ctacaagccc aaggcattcc agctatcacg       780
     tatcacgctg ggctggagcc ggaacgccgt gaagaggctt taatgcattt tttagaagct       840
     gatgcgcctg ttttggtggc caccgtggcg tttgggatgg gcgttgaccg tccggatgtg       900
     gggttggtct tgcacttgga tttgcctgcg acaccagagg gatatctcca ggagtcaggt       960
     cgcgctggac gcgatggcag accggcccat tgtcttgtgt tgttttcacc tggagaccga      1020
     accagcttgg gctgggcgat gcagtccacg ttgcgccgtg cgtctgaatc caaggtgtct      1080
     gacgatgatg tttggcgcgt ggagttttct cagcagcaat tgaggcgaat ggaggctgtt      1140
     gctgagggtg agatttgccg agaacaggct ctgctgcttt cagtgggcga gctgacgtct      1200
     ccttgcggcc gctgtgatcg ctgcctggct caagtgcggc ccaaggattg gtcggatcgc      1260
     gcccaagaat tgttggaggt gatcgatgcc ggtcagggag cagacatccg cagcctgacc      1320
     gagcgattac gggagcttga tggcagcgaa gagcgttggg gttggcttgc gcgcaggctc      1380
     gtgcaagagg agctcattcg tgagagcaac gatggtgccc aacgcttgtc gttaagggat      1440
     agcggcagac aattcctgca tgccccttgg cccttgcatt acgcagcttg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page