(data stored in SCRATCH3701 zone)

EMBL: CP000435.RIMM

CP000435.RIMM        Location/Qualifiers
FT   CDS_pept        complement(204839..205402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="sync_0195"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45739"
FT                   /db_xref="GOA:Q0IDP0"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDP0"
FT                   /protein_id="ABI45739.1"
FT                   /translation="MTSTPSPSTADPNSTNDWLPVGTLVGAQGLKGELRLNPASDFPER
FT                   FTEPGTRWLQAKGSAPKEVELLEGRQLPGKSLYVVRLKGVNNRASAEALVGCTVLVPAK
FT                   DRPELAEGEFHLLDLVGLEARLAGSDEPIGTVSNLISGGNDLLEIKLNSGKTVLVPFVE
FT                   AIVPDVQLEEGWLLLTPPPGLLEL"
     atgacttcca ctccgtcacc cagtacagct gatccgaaca gcaccaacga ttggctaccg        60
     gtgggaacgc tcgttggcgc tcaaggatta aagggggaac tgcgcctcaa cccggccagt       120
     gattttcccg aacgcttcac cgaaccaggg actcgttggc tgcaagccaa gggatcagct       180
     ccaaaagagg tggagctact cgaggggcga cagctgccag gcaaaagcct ctatgtggtg       240
     cgtttaaaag gcgtgaacaa ccgcgccagt gcagaagcac tcgtgggctg cacagtgctg       300
     gtgcctgcca aagacaggcc cgagctcgcc gaaggggaat ttcatctact cgacctggtg       360
     ggattagagg cacgcttggc cggcagtgat gaaccgatcg gcacggtgag caacctgatc       420
     agcggcggta atgacctgct ggagatcaag ctcaacagcg gcaaaacggt attggttccc       480
     ttcgtggagg caatcgttcc agacgtgcag ttggaggaag gctggttgct gctcacccca       540
     ccaccggggt tgctggagct ttaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page