(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLB

CP000435.RPLB        Location/Qualifiers
FT   CDS_pept        complement(433324..434187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="sync_0434"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:Q9Z9L1; match to
FT                   protein family HMM PF00181; match to protein family HMM
FT                   PF03947; match to protein family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45224"
FT                   /db_xref="GOA:Q0ID08"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID08"
FT                   /protein_id="ABI45224.1"
FT                   /translation="MAIRTFRPYTPGTRTRVVTDFSEVTGRKPERSLVVSKHRRKGRNN
FT                   RGVITCRHRGGGHKRQYRLVDFRRNKHGVTAKVAAIHYDPHRNARLALLFYADGEKRYI
FT                   LAPAGISIGQTVVSGTEVPIEIGNAMPLSAIPLGSSVHCVELYAGRGGQMVRTAGASAQ
FT                   VMAKEGDYVALKLPSTEVRLVRRECFATLGEVGNAEIRNTSLGKAGRRRWLGRRPQVRG
FT                   SVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNKFVLRKRRKTSKRS
FT                   RGGRDS"
     atggcaattc gtactttccg cccctacacc cccggtacca gaacccgggt agtcacagac        60
     ttcagtgaag tcaccggccg caagccggag cgctccttgg tggtgtcgaa acaccgccgc       120
     aaaggacgca acaatcgagg tgtgatcacc tgccgtcatc gcggaggtgg tcataagcgc       180
     caataccgct tggtcgactt ccgtcgcaac aagcatggag tcaccgccaa agtggctgcc       240
     atccactacg accctcaccg caatgcgcgg ttggccctgc ttttttacgc cgatggcgaa       300
     aagcgataca tcctggctcc ggctgggatc agcatcggcc aaacagtcgt ttcaggcact       360
     gaggtgccga tcgagatcgg caatgccatg ccgctctcag ccatcccact cggttcaagc       420
     gttcattgcg ttgagcttta tgccggacgc ggtggtcaga tggttcgaac cgcaggagca       480
     agtgctcagg tcatggccaa agagggcgat tacgtcgccc tcaagctccc ctccactgag       540
     gtgcgcctcg tgaggcgtga gtgcttcgcc actcttggcg aagtaggcaa cgctgaaatt       600
     cgcaacacca gcttgggcaa agctggtcgc cgccgttggc tggggcgtcg tcctcaggtc       660
     cgaggcagcg tgatgaaccc ttgcgatcac cctcatggtg gtggtgaagg ccgtgctcct       720
     attgggcgct cgggacctgt caccccttgg ggcaaacccg ctctgggcct caaaacccgc       780
     aagcggaata agcccagcaa caagttcgtc ctccggaaac gtcgcaagac gtccaagcgg       840
     agccgtggcg gacgcgattc ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page