(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLC

CP000435.RPLC        Location/Qualifiers
FT   CDS_pept        complement(435133..435789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="sync_0437"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45670"
FT                   /db_xref="GOA:Q0ID05"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID05"
FT                   /protein_id="ABI45670.1"
FT                   /translation="MSIGILGKKLGMSQFFDEQGKAVPVTLIEAGPCRITQLKSSETDG
FT                   YQAVQIGFGEIREKLINKPAKGHLAKSGEDLVRHLCEYRVDDLDGIQLGGAVTVGDFAA
FT                   GQKVDVSGDTMGRGFAGLQKRHGFSRGPMTHGSKNHRQPGSIGAGTTPGRIYPGKRMSG
FT                   RYGGKKITTRGLTILKIDSERNLLVVKGSVPGKPGSLLNIRPANRVGAKPAKGGK"
     atgtctatcg gcattcttgg gaagaaattg ggcatgtccc aattcttcga cgagcaaggc        60
     aaagccgtcc cggtcacatt gatcgaggca ggcccttgcc gcatcaccca gctcaaaagc       120
     tcagaaactg acggctatca agccgtacag atcggttttg gcgagattcg cgaaaagctg       180
     attaacaaac ccgcgaaagg tcatctcgcc aaatctggcg aggacctagt gcgtcacctc       240
     tgtgaatatc gcgtcgatga cctcgatggg attcagttag gtggtgccgt caccgtcggt       300
     gacttcgcgg ctggtcagaa agtcgacgtc agtggcgaca ccatgggtcg tggctttgct       360
     ggtctgcaaa agcgccatgg tttcagtcgt ggtccaatga cgcacggctc caaaaatcat       420
     cgccaacccg gttcgatcgg tgccggcaca acgccaggga ggatttatcc cggcaaacgg       480
     atgtccggtc gctacggcgg caaaaaaatc acaacccgtg gtttgacgat ccttaaaatt       540
     gacagcgaac gcaaccttct cgtggtgaaa ggttctgttc ctggcaaacc aggttcactg       600
     ctgaacatcc gtcccgcaaa ccgggtgggc gccaagcccg ccaaaggagg taagtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page