(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLF

CP000435.RPLF        Location/Qualifiers
FT   CDS_pept        complement(428623..429162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="sync_0423"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46694"
FT                   /db_xref="GOA:Q0ID19"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID19"
FT                   /protein_id="ABI46694.1"
FT                   /translation="MSRIGKNPIPIPDKVNVTLSGLAVTVKGPKGELKRTLPSGVSVNQ
FT                   VDNSIVVAPTSTKRSSRERHGLCRTLVANMVIGVSQGYSKKLEIVGVGSRAQVKGKTLV
FT                   VSAGYSHPVEVVPPEGITFTVENNTNVTVSGTDKELVGNEAAKIRAIRPPEPYKGKGIK
FT                   YAGERILRKAGKSGKK"
     atgtcacgta ttggtaaaaa cccaatcccc attcccgaca aggtgaatgt cacactcagc        60
     ggtcttgccg tcactgtgaa gggacccaag ggtgagctca aacgcaccct tcctagtggt       120
     gtgagtgtca accaggtgga taactccatc gtggtcgcac ccaccagcac aaaacgcagt       180
     tcccgtgaac gtcacggcct gtgcagaact ctcgtcgcca acatggtgat cggagtgagt       240
     cagggctatt ccaaaaagct ggagatcgtt ggcgtgggct cccgagccca ggtcaaaggc       300
     aaaaccctcg tggtaagtgc tggctacagc catccagtgg aagtggtgcc tcctgaaggc       360
     atcactttca cggttgagaa caacaccaac gtcaccgtct caggcaccga caaggaattg       420
     gttggcaatg aagccgccaa gatccgcgca atccgtcctc ccgagcccta caaaggcaag       480
     ggaattaaat atgcgggcga gcgcatcctg cgtaaggcag gcaagtcggg caagaagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page