(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLN

CP000435.RPLN        Location/Qualifiers
FT   CDS_pept        complement(430546..430911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="sync_0427"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47567"
FT                   /db_xref="GOA:Q0ID15"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID15"
FT                   /protein_id="ABI47567.1"
FT                   /translation="MIQQETFLTVADNSGAKRIQCIRVLGTNRRYAHVGDVIVATVKDA
FT                   MPNMGVKKSDIVKAVVVRTKATMRRDTGNSIRFDDNAAVIINDDKNPKGTRVFGPVARE
FT                   LRERSFTKIVSLAPEVI"
     atgattcagc aggaaacatt cctcactgtt gctgacaaca gtggcgccaa acgcatccag        60
     tgcattcgtg ttctcggcac caatcgccgc tatgcgcacg ttggtgacgt gatcgttgcc       120
     accgtcaaag atgcgatgcc aaacatgggt gtcaaaaagt cggacatcgt caaggccgtt       180
     gtggttcgaa ccaaagccac aatgcgtcga gatacgggta actccattcg ttttgatgac       240
     aacgcagccg tgatcatcaa cgacgataaa aatcccaaag gcactcgcgt ctttggaccg       300
     gttgcccgtg aattgcgtga acgcagtttc accaaaatcg tgtccctcgc tccggaggtg       360
     atctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page