(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLP

CP000435.RPLP        Location/Qualifiers
FT   CDS_pept        complement(431406..431873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="sync_0430"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45536"
FT                   /db_xref="GOA:Q0ID12"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID12"
FT                   /protein_id="ABI45536.1"
FT                   /translation="MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSR
FT                   QIEASRRAMTRYVKRGGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILF
FT                   EMGGEEITPEIAKEAMRLAQYKLPLKTKFICLDEQEQPAGTKAAASSTVES"
     atgctgagtc ccaaaagagt caaattccgc aaacaacagc gaggtcgcat gcgcggcgtc        60
     gctaccagag gcaacaccat tgcctttggt cagtttgcgt tgcaagccca agaatgcggc       120
     tggattactt cgcgtcaaat cgaagccagc cgacgtgcca tgacccgcta cgtcaaacgt       180
     ggcggaaaaa tctggattcg aatctttcct gacaagcccg tcaccatgcg tcctgctgaa       240
     acccgaatgg gttctggtaa gggcaaccca gaattctggg ttgcggtgat caagcccggc       300
     aggattctgt tcgagatggg cggtgaagaa atcacccctg agattgcgaa ggaagcaatg       360
     cgccttgcgc aatacaagct cccgctaaaa acaaagttca tctgcctcga tgaacaggaa       420
     cagccagccg gcactaaggc tgctgcctct tcaaccgtgg agtcctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page