(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLR

CP000435.RPLR        Location/Qualifiers
FT   CDS_pept        complement(428221..428589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="sync_0422"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47544"
FT                   /db_xref="GOA:Q0ID20"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID20"
FT                   /protein_id="ABI47544.1"
FT                   /translation="MSTLSRKQQTQKRHRRLRRHLSGTANRPRLAVFRSNSHIYAQLID
FT                   DEAQSTLCSASTLDKDLRSSLKTNCSSCDASVAVGDLVAKRAIAKGIQQVVFDRGGNLY
FT                   HGRVKALADAAREAGLQF"
     atgtcgaccc tctcccgcaa acagcagact cagaaacgcc acaggcgtct gcgtcgccat        60
     ctcagtggca cggccaatcg tccaagactg gccgtgttcc gctccaacag tcacatctac       120
     gctcagttga tcgacgacga agctcagagc actctgtgtt ctgcttccac cctcgacaaa       180
     gacctgcgct ccagcctcaa aactaattgc agcagctgtg atgcgtctgt tgccgttggc       240
     gatttagtgg ccaaacgtgc cattgccaaa ggcattcaac aagttgtctt cgatcgaggc       300
     ggcaacctgt accacggccg ggtgaaagct cttgccgatg ccgcccggga agcgggcctt       360
     cagttctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page