(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPLV

CP000435.RPLV        Location/Qualifiers
FT   CDS_pept        complement(432643..433008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="sync_0432"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46042"
FT                   /db_xref="GOA:Q0ID10"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID10"
FT                   /protein_id="ABI46042.1"
FT                   /translation="MTTSSPTATTAQAHGRFIRGSVSKVRRVLDQIRGRTYRDALIMLE
FT                   FMPYRSTGPITKVLRSAVANAEHNLGLDPASLIISQATADMGPSMKRYRPRAQGRAYAI
FT                   KKQTCHISIAVAAQTDS"
     atgacaacgt catccccaac ggcaaccact gcccaagcgc acggccgctt cattcgcggc        60
     tccgtttcca aggtgcgtcg cgtactcgat caaatccgtg gccgcaccta ccgcgacgcg       120
     ctgatcatgc tcgagttcat gccctaccgc tcgaccggtc cgatcacgaa agtgcttcgt       180
     tccgccgtcg ccaatgccga gcacaatctt ggacttgacc cagcgagcct gatcatttcc       240
     caggccaccg ctgacatggg tccatccatg aagcggtatc ggccccgcgc tcaaggtcgc       300
     gcctacgcga tcaaaaaaca gacctgccac atcagcattg ctgtggcagc tcagaccgac       360
     tcctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page