(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPME

CP000435.RPME        Location/Qualifiers
FT   CDS_pept        complement(420406..420672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="sync_0409"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45194"
FT                   /db_xref="GOA:Q0ID33"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID33"
FT                   /protein_id="ABI45194.1"
FT                   /translation="MPKPDIHPTWYPDAKVICNGEVVMTTGSTQPEINVDVWSGNHPFF
FT                   TGTQKILDTEGRVDRFMRKYGMGSVDNATSEKKSATDETSKES"
     atgcctaaac ccgacattca cccaacctgg tatccggacg cgaaggtcat ttgcaacgga        60
     gaagttgtga tgacgaccgg ttccacgcag cctgaaatca atgtcgatgt atggagtggg       120
     aaccatccct tcttcacagg cacacaaaag atcctcgaca ccgaagggcg agtggatcgc       180
     ttcatgcgta agtacggcat gggaagtgtt gacaacgcaa cctctgagaa gaagtcggca       240
     acagacgaga cttccaaaga gtcctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page