(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSA

CP000435.RPSA        Location/Qualifiers
FT   CDS_pept        complement(513071..513988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="sync_0531"
FT                   /product="ribosomal protein S1"
FT                   /note="identified by similarity to SP:P46228; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47704"
FT                   /db_xref="GOA:Q0ICR5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR5"
FT                   /protein_id="ABI47704.1"
FT                   /translation="MDGAGFTIDDFASLLSKYDYNFKPGDIVNGTVFALETKGAMIDIG
FT                   AKTAAFMPLQEVSINRVEGLSDVLQPGEIREFFIMSEENEDGQLSLSVRRIEYQRAWER
FT                   VRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISTRKPKEELVADFLPLKFLE
FT                   VDEERNRLVLSHRRALVERKMNRLEVGEVVIGTVRGIKPYGAFIDIGGVSGLLHISEIS
FT                   HEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKALEPEPGDMLTDPQKVFDKAEEM
FT                   AARYKQMLLEQAEEGEEPLSSMMV"
     ttggatggag ccggcttcac gattgatgat ttcgcctcac ttcttagcaa gtacgactac        60
     aacttcaagc caggcgacat tgttaacggc acagtattcg cgctggagac aaagggggca       120
     atgatcgata tcggcgccaa aacagccgca ttcatgccac tccaagaggt ctctatcaac       180
     agagtggaag gtctcagcga cgtgttgcaa cccggtgaga ttcgggaatt cttcatcatg       240
     agtgaagaga acgaagacgg ccaactctct ctctcggttc gccgtatcga gtatcagcgt       300
     gcctgggaac gggtgcgtca gctgcaaaaa gaagacgcca ccatttattc agaagtgttc       360
     gccaccaacc gtggtggtgc gctcgttcgg gtggaaggcc tgcgcggctt catccctgga       420
     tcccacatca gcacgcgcaa acctaaagaa gagctggttg cagacttctt gcctctcaag       480
     ttcctcgaag tcgacgaaga gcgcaatcgt ttggttctca gtcatcgccg cgccctggtc       540
     gagcgcaaga tgaatcgcct tgaggtcggc gaagtggtga tcggaaccgt tcgtggcatc       600
     aagccttacg gcgcgtttat cgacatcggt ggggtgagcg gtttgcttca catttccgaa       660
     atcagtcacg agcacatcga aacgccccat tccgtgctga atgtgaatga tcaaatgaaa       720
     gtgatgatca tcgatctaga tgctgaacgc ggtcggatct cactctctac caaggcactg       780
     gagccagaac ccggtgacat gctcaccgat cctcaaaagg tctttgataa ggcagaggaa       840
     atggctgctc gctacaagca gatgcttctt gagcaagcgg aagaaggaga agagcccttg       900
     agctcgatga tggtctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page