(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSE

CP000435.RPSE        Location/Qualifiers
FT   CDS_pept        complement(427560..428252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="sync_0421"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45077"
FT                   /db_xref="GOA:Q0ID21"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID21"
FT                   /protein_id="ABI45077.1"
FT                   /translation="MPPGKRAFSSDPALTMTTEPNNQTTSNDVPSASDVPAAAEGQGQQ
FT                   QEQRRGGGRGDRRGGRGDRRRGQERDSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN
FT                   ERGQVGVGVGKAGDVIGAVRKGVADGKKHLVKVPLTRHNSIPTLSNGRDGAASVLIRPA
FT                   APGTGVIAGGSIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALQLLRTHKETAKERG
FT                   ISLEQIYS"
     atgccgcccg ggaagcgggc cttcagttct gatcctgctc tcactatgac gaccgaaccc        60
     aacaaccaga ccacctccaa cgacgtgcca tcggcttctg acgttccggc agcagctgaa       120
     ggtcaaggcc aacaacagga gcagcgccgc ggcggcggcc gcggtgaccg tcgcggcggt       180
     cgcggcgacc gtcgccgcgg ccaagaacgg gattccgaat ggcaagagcg cgttgtgcag       240
     atccgtaggg tctccaaaac cgtcaaaggc ggcaaaaaga tgagcttccg cgccatcgtt       300
     gttgtcggca atgagcgcgg tcaggttggc gttggtgtcg gcaaggccgg cgatgtcatc       360
     ggtgccgtac gcaagggcgt cgctgatggc aaaaagcacc tggtgaaagt tcctttaacc       420
     cgccacaact caatcccgac tctgtcgaat ggtcgtgatg gcgcagccag tgttctcatc       480
     cgcccagccg ctcctggtac cggtgttatc gccggtggat ccattcgtac ggtgctagag       540
     ctcgcaggca ttaaaaatgt cttggcgaag cgcctgggaa gcaaaactcc tctgaataac       600
     gctcgggctg ccatggtggc cctacaactg ctccgcactc acaaggagac agccaaggaa       660
     cgggggatct ccctcgagca gatctactcc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page