(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSG

CP000435.RPSG        Location/Qualifiers
FT   CDS_pept        complement(389733..390203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="sync_0383"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47000"
FT                   /db_xref="GOA:Q0ID57"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID57"
FT                   /protein_id="ABI47000.1"
FT                   /translation="MSRRNAAVKRPILPDPQFNNRLATMMVARLMKHGKKSTAQRILSD
FT                   AFGMIGERTGGDPVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWL
FT                   VNFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY"
     atgtctcgcc gtaacgcagc agtcaaacgt ccgattctgc cggatccaca attcaacaat        60
     cggctcgcca cgatgatggt ggcccgctta atgaagcacg gaaaaaagtc caccgcccaa       120
     cgcatcttgt cggatgcctt tggaatgatc ggtgaacgca ccggtggtga tcctgtagaa       180
     ctgttcgaaa cggcagtcaa gaacgcgact ccacttgtag aagttcgtgc acgccgtgtt       240
     ggtggtgcta cttatcaagt tccgatggaa gtgcgccaag agaggggcac tgcaatggcc       300
     ctgcgttggc tcgtcaattt ctcaagagct cgtaatggtc gcagcatggc ccaaaagctt       360
     gctggagaat taatggatgc tgccaacgaa gctggtagtg ccgtccgcaa acgggaagaa       420
     actcacaaga tggccgaagc caacaaagca ttcgcccact atcgctactg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page