(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSH

CP000435.RPSH        Location/Qualifiers
FT   CDS_pept        complement(429178..429579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="sync_0424"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46346"
FT                   /db_xref="GOA:Q0ID18"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID18"
FT                   /protein_id="ABI46346.1"
FT                   /translation="MANHDPISDMLTRIRNASEKRHESTKVPASRMSRSIAKVLQQEGF
FT                   IAEISEQGEGVRTELVLGLKYSGKHRQPTIRSMQRVSKPGLRIYKNTRGLPKVLGGLGV
FT                   AIISTSKGVMSDRDARKQGVGGEVLCYVY"
     atggctaatc acgacccaat ttccgacatg ctcactcgca tccgcaatgc gagtgaaaaa        60
     cgtcacgagt ccacaaaagt tccagcctct cgcatgtccc gcagcattgc caaagtgctg       120
     caacaagagg gatttatcgc tgaaatcagc gagcaaggcg agggtgtccg caccgaattg       180
     gtgctgggac tcaagtacag cggcaaacac cgccaaccca ccattcgctc catgcaaagg       240
     gtcagcaagc ctggcctccg catatacaaa aacacgcgcg gcctgcccaa ggtcctcggt       300
     ggactagggg tagccatcat ctccacctct aagggtgtga tgagcgaccg cgacgcccgc       360
     aaacaaggcg tgggcggcga agtgctctgc tacgtctatt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page