(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSJ

CP000435.RPSJ        Location/Qualifiers
FT   CDS_pept        complement(385863..386183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="sync_0380"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46021"
FT                   /db_xref="GOA:Q0ID60"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID60"
FT                   /protein_id="ABI46021.1"
FT                   /translation="MSTAIAQQKIRIRLKAFDRRMLDLSCDKIIETADNTAATAIGPIP
FT                   LPTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYSPSAKTIDALMKLDLPSGVDIEV
FT                   KL"
     atgtccaccg caatcgctca gcaaaagatc cgcattcgtc tcaaggcgtt tgatcgccgc        60
     atgctggatc tctcttgcga caaaatcatt gaaactgccg acaacacggc ggcaacggcc       120
     atcggtccta ttccattgcc aacgaagcgc aaaatctatt gcgttctgcg ctcgccccac       180
     gtggataagg attcacgcga gcactttgaa accaggaccc atcgacgcat catcgatatc       240
     tatagccctt ctgctaagac catcgacgct ctgatgaagc tcgacctccc cagtggggtc       300
     gatatcgagg tcaagctctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page