(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSM

CP000435.RPSM        Location/Qualifiers
FT   CDS_pept        complement(424487..424852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="sync_0416"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46073"
FT                   /db_xref="GOA:Q0ID26"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID26"
FT                   /protein_id="ABI46073.1"
FT                   /translation="MARIAGVDIPRDKRIEVALTYIYGIGSTRAKTILTKAGVNPDIRV
FT                   KDLEDNDVQKLRNATESFTIEGDLRRQEGMALKRLQDIGCLRGRRHRMSLPVRGQRTRT
FT                   NARTRRGARKTVAGKKK"
     gtggcaagga ttgctggtgt tgacattccc cgcgacaagc ggatcgaagt cgcacttact        60
     tacatctacg gaatcggctc aactcgggcc aagaccatcc tcaccaaagc cggagtcaac       120
     cctgacatcc gtgtgaagga tctcgaggac aacgatgtgc agaaattgcg caacgccact       180
     gagtccttca cgatcgaggg agatctgcgg cgccaagagg gcatggccct taagcgcctg       240
     caagacattg gctgcctgcg tggccgtcgt catcggatga gccttcctgt tcgcggtcaa       300
     cgaacccgca ccaacgcccg cacccgccgt ggcgccagga agactgtggc cggcaagaag       360
     aaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page