(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSS

CP000435.RPSS        Location/Qualifiers
FT   CDS_pept        complement(433013..433288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="sync_0433"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45542"
FT                   /db_xref="GOA:Q0ID09"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID09"
FT                   /protein_id="ABI45542.1"
FT                   /translation="MGRSLKKGPFIADSLLRKVEKQNAADDKSVIKTWSRASTILPMMI
FT                   GHTIAVHNGRTHVPVFVTEQMVGHKLGEFAPTRTFKGHIKDKKGGR"
     atgggacgtt ctctcaaaaa aggcccattt attgctgaca gccttcttcg caaggttgaa        60
     aagcaaaacg cggctgacga caagtcagtc atcaagacgt ggtccagggc ctccacaatt       120
     ttgccgatga tgatcggcca taccattgcc gttcacaacg gcagaaccca cgtaccagtc       180
     ttcgtgactg agcaaatggt ggggcacaaa ttgggtgaat tcgcacccac acgcaccttt       240
     aagggccaca tcaaagacaa gaaaggaggc cgctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page