(data stored in SCRATCH3701 zone)

EMBL: CP000435.SAT

CP000435.SAT         Location/Qualifiers
FT   CDS_pept        357627..358796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sat"
FT                   /locus_tag="sync_0354"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="identified by match to protein family HMM PF01747;
FT                   match to protein family HMM TIGR00339"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47244"
FT                   /db_xref="GOA:Q0ID86"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID86"
FT                   /protein_id="ABI47244.1"
FT                   /translation="MTASSSSSQRSGVIAPYGGTLVDLMASATEHAALKASATTSIECS
FT                   DRNACDVELLVVGGFSPERGFMHQADYDSVVAGHRTTSGYLFGLPIVMDTDREDVAVGD
FT                   KVLLTYKGQDLAVLTVGDKWEPDKVVEAKGCYGTTSLEHPAVRMIATERRRYYLGGLIQ
FT                   GLQLPERVFPCKTPAEVRAGLPDGEDVVAFQCRNPIHRAHYELFTRALHAQNVSENAVV
FT                   LVHPTCGPTQQDDIPGAVRFQTYERLAAEVDNSRIRWAYLPYAMHMAGPREALQHMIIR
FT                   RNYGCTHFIIGRDMAGCKSSLSGDDFYGPYDAQNFAKECAPELTMETVPSLNLVFTDEE
FT                   GYVTAEHAEARGLHVKKLSGTQFRKMLRSGEEIPEWFAFRSVVEVLRAS"
     atgactgcca gttcctcttc ctcacagcgc tccggggtga ttgctcctta cggaggcacc        60
     ttggtggatt tgatggcgtc agccacggag catgccgcgc tgaaggcttc tgccaccaca       120
     agcatcgaat gttccgatcg caatgcctgt gatgttgagc tgcttgtagt gggtggattc       180
     tctccagagc gcggattcat gcatcaggcc gactacgact ccgttgttgc cgggcatcgc       240
     accacgtctg gatacctgtt tgggttgccg atcgtgatgg ataccgaccg tgaggacgtc       300
     gcggttggag acaaggtgtt gttgacctac aaaggtcagg atctcgctgt tctcaccgtt       360
     ggtgataagt gggaacccga caaggttgtc gaagccaaag gttgctacgg caccacctcg       420
     ctagagcacc ctgcggtgcg catgatcgcc acggagcgcc gtcgctacta cctcggtggt       480
     ttgattcagg gcttgcagct tccggagcgt gtcttccctt gcaaaacgcc agctgaggtc       540
     cgagcaggcc tccccgacgg cgaagacgtg gtggcattcc agtgtcgtaa tcccattcat       600
     cgcgcccact acgagctctt cacccgtgca ctgcacgccc aaaatgtcag tgagaacgcc       660
     gttgtgctgg tccaccccac ctgtgggccc acccagcagg acgacatccc tggcgccgtc       720
     cgctttcaga cctatgaacg cctggcagca gaagtggata attcgcgcat tcgttgggcc       780
     tatctgcctt atgccatgca catggcgggt cctcgtgaag ccctgcagca catgatcatc       840
     cgccggaact acggctgcac gcacttcatc attggccggg atatggctgg ctgtaaatcc       900
     tccctctccg gggacgattt ttacggacca tatgacgcgc agaatttcgc caaagaatgt       960
     gctcctgaac tgacgatgga gaccgttcct tccttgaatc tcgtctttac cgacgaagag      1020
     gggtatgtca ctgcggaaca tgcggaggcc cgcggtctgc atgtcaaaaa gctcagcggc      1080
     acccaattcc gcaagatgct tcgcagtggc gaggagatcc cggagtggtt tgcgttccgc      1140
     agcgtggttg aggtccttcg ggcctcctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page