(data stored in SCRATCH3701 zone)

EMBL: CP000435.SECA

CP000435.SECA        Location/Qualifiers
FT   CDS_pept        90095..92947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="sync_0086"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF01043;
FT                   match to protein family HMM PF07516; match to protein
FT                   family HMM PF07517; match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45024"
FT                   /db_xref="GOA:Q0IDZ9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDZ9"
FT                   /protein_id="ABI45024.1"
FT                   /translation="MLKLLLGDPNARKLKRYQPIVSDINLLEEEIEPLSDDDLRRRTAE
FT                   FRQRLEAAGSLDKQRPLLDDLLPEAFAVVREAGKRVLGMRHFDVQMIGGMVLHEGQIAE
FT                   MKTGEGKTLVATLPSYLNALTGRGVHVVTVNDYLARRDAEWMGQVHRFLGLSVGLIQQD
FT                   MTPAERRINYGCDITYATNSELGFDYLRDNMAADINEVVQREFQFCVIDEVDSILIDEA
FT                   RTPLIISGQVERPQEKYEKAAEVANALERAAEMGKDGIDPEGDYEVDEKQRSSTLTDEG
FT                   FTKAEALIGVADLYNPQDPWAHYITNALKAKELFVRDVNYIVRDGEAVIVDEFTGRVMP
FT                   GRRWSDGQHQAIEAKEGLAIQPETQTLASITYQNFFLLYPRLAGMTGTAKTEEVEFEKT
FT                   YSLQTAIVPTNRVRARQDWVDQVYKTETAKWRAVAKETAEVHKQGRPVLVGTTSVEKSE
FT                   LLSALLAEENIPHNLLNAKPENVEREAEIVAQAGRAGSVTIATNMAGRGTDIILGGNSD
FT                   YMARLKLREVLLPRLVRPEDDHRPPVPLQRSEEGGGGFSATAPASGPHGNAPSEAKAIG
FT                   NLYPCQLTEETDQALVELAKQLVKAWGDRALSVIELEDRIATAAEKAPTEDPEIAQLRA
FT                   SIAQVKGEYDAVVKQEEMGVREAGGLHVIGTERHESRRVDNQLRGRAGRQGDPGSTRFF
FT                   LSLGDNLLRIFGGERVAGLMNAFRVEEDMPIESGMLTRSLEGAQKKVETYYYDIRKQVF
FT                   EYDEVMNNQRKAVYTERRRVLDGRELKKQVIGYGERTMNEIVEAYVNPDLPPEEWDVSQ
FT                   LVSKVKEFVYLLEDLQPDQLQGLSMDDLKAFLQEQLRNAYDLKEGEIEELRPGLMREAE
FT                   RFFILQQIDTLWREHLQAMDALRESVGLRGYGQKDPLIEYKNEGYDMFLEMMTNMRRNV
FT                   IYSMFMFRPAPPAAAQATTA"
     atgctcaagc tcctgctggg tgaccccaac gcccgcaagc tgaagcgtta tcagccgatc        60
     gtttcagata tcaatctgct tgaggaggag attgagcctc tgagcgacga tgacctgcgc       120
     cgccgtacgg ctgagttccg ccagcgctta gaagctgctg gatcgctgga taaacaaagg       180
     cctttattgg atgacttgtt gcccgaggcc ttcgccgttg tgcgtgaagc cggtaagcga       240
     gtgctgggca tgcgccactt cgacgtgcaa atgatcggtg gcatggtgct gcacgagggg       300
     caaatcgccg agatgaaaac cggtgagggc aaaaccctcg ttgcaaccct ccccagctac       360
     ctcaacgcgc tcacaggccg cggtgtacat gtggtcaccg tgaacgacta cttggctcgc       420
     cgcgatgcgg aatggatggg gcaagtgcat cgattccttg gcctatcggt gggcttgatc       480
     cagcaagaca tgaccccggc tgaacgccga attaattacg gctgtgacat cacctatgcc       540
     actaattcag agcttggatt tgattatctg cgcgacaaca tggccgcaga tatcaatgag       600
     gtggtgcagc gtgagtttca gttttgtgtg atcgacgaag tcgactcaat cctgattgat       660
     gaagcacgca cgcccttgat catttcaggc caggtggaac gcccccagga gaaatatgag       720
     aaggcggcag aggtggcgaa cgctctagag cgggccgccg aaatggggaa ggacggcatc       780
     gaccccgaag gtgattacga ggtggatgaa aagcagcgca gttccacact caccgatgag       840
     ggatttacca aggctgaggc cttaattgga gtggccgatc tctacaaccc tcaggatcct       900
     tgggctcact acatcaccaa tgccttaaag gcaaaagaac tattcgttcg cgatgtcaac       960
     tacatcgttc gcgatggtga ggcggtgatc gtggatgagt tcacaggaag ggtgatgcca      1020
     ggccggcgtt ggagtgatgg gcagcaccaa gcgattgagg ccaaggaggg cttagcgatt      1080
     cagccagaaa cgcaaaccct ggcttcgatt acttatcaaa atttctttct tctctatccc      1140
     cgtttggctg ggatgactgg tactgccaaa acggaggaag tggaatttga gaagacctac      1200
     tccttgcaaa ccgccatcgt gcctacgaac cgggtgcgtg ctcgccagga ctgggtggat      1260
     caggtgtaca aaacggaaac ggcgaaatgg cgtgccgttg ccaaagaaac cgctgaggtg      1320
     cataagcaag gtcgccccgt tttggtgggc accaccagtg ttgagaaaag tgagctactc      1380
     agtgcactgt tggcggagga aaacatcccc cacaacctgc tcaatgccaa accagaaaac      1440
     gtagagcggg aggcggaaat tgttgctcag gcaggaagag ctggctctgt gaccatcgcc      1500
     accaacatgg cgggccgtgg caccgacatc attcttggtg gcaacagcga ttacatggcg      1560
     cgcctcaagt tgcgcgaagt gctacttccc cggctggtgc ggccggagga tgatcatcgc      1620
     ccccccgtgc ctctccagcg cagcgaggaa ggcggtggcg ggttctctgc cacggctcct      1680
     gccagtggtc cccacggcaa tgcccccagt gaagccaagg cgattggcaa cctctatccc      1740
     tgccagctca cggaggagac agatcaagcc ttagtggagc ttgccaagca gctggtgaaa      1800
     gcttggggtg atcgcgctct cagcgtgatc gaactggaag atcgcattgc cacggcagca      1860
     gaaaaagccc ccacagaaga tcctgagatt gcccagttgc gtgcctcgat cgcccaggtg      1920
     aaaggcgaat acgacgctgt ggtgaaacag gaggagatgg gcgtgcgcga ggctggaggc      1980
     ctgcacgtga ttggcaccga gcggcacgaa tcacgccggg ttgataacca acttcgtggg      2040
     cgtgctggcc gtcagggtga tccaggcagc acgcgattct tcttgtcgct tggcgacaac      2100
     cttctgcgca tctttggtgg tgagcgtgtg gctggattga tgaatgcctt ccgggtggag      2160
     gaagacatgc cgattgaatc gggcatgctc acgcgctctc ttgagggggc gcaaaagaag      2220
     gttgagacgt actactacga catccgtaag caggtgtttg agtacgacga agtgatgaac      2280
     aatcagcgca aggcggtgta caccgagcgc cgccgtgtgc tcgatggccg tgaactcaaa      2340
     aaacaggtga ttggctacgg cgaacgcacc atgaatgaga ttgttgaggc ctatgtgaat      2400
     ccagaccttc cacccgagga atgggatgta tcgcaactgg taagcaaggt aaaagagttt      2460
     gtttatctgc tcgaagacct gcagcctgac caactccagg gcctttcgat ggatgatctc      2520
     aaggccttcc tgcaagagca gttacgtaat gcctacgacc ttaaagaagg cgagattgag      2580
     gagttgcgtc cagggctgat gcgagaggct gagcgtttct tcatccttca acagattgac      2640
     actctctggc gtgaacatct tcaggccatg gatgccctgc gtgaatcggt gggattacgt      2700
     ggttatgggc agaaagatcc gttgattgaa tataaaaatg agggctacga tatgttcctc      2760
     gagatgatga cgaatatgcg ccgcaatgtg atctattcga tgtttatgtt ccggcccgct      2820
     ccgcctgcag cagcgcaggc gaccacggct taa                                   2853
//

If you have problems or comments...

PBIL Back to PBIL home page