(data stored in SCRATCH3701 zone)

EMBL: CP000435.SFSA

CP000435.SFSA        Location/Qualifiers
FT   CDS_pept        complement(305280..306032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="sync_0294"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45699"
FT                   /db_xref="GOA:Q0IDE3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE3"
FT                   /protein_id="ABI45699.1"
FT                   /translation="MTGTSILQFPVLSEGVLLKRYKRFLADVELKDGQVVTVHCANTGP
FT                   MKGVLHPGGRVRVRHAPSPKRKLAWTWEQAEIPSSDGTLCWAGINTALPNKLIRALIEA
FT                   GGLKDQLGPIKTIRAEVPYGLNRRSRIDLLLTPDDSADDQRPIYVEVKNTTWSHGDVAL
FT                   FPDTVTERGQKHLEELTALLPDARGVLVPCLSRPDVIAFAPGDSADPRYGDLFRQAMAA
FT                   GVEVLPCCFSFYEDQIQWEGVRTVCPRL"
     atgaccggca cgtcgatcct tcaatttcct gtcctcagcg aaggtgtgct cctgaagcgc        60
     tacaaacgct ttctggctga tgtggagctc aaagatggac aagtcgtcac cgtccactgt       120
     gccaacactg ggcccatgaa aggcgtgctc catcccggtg ggagagtcag ggtccgccat       180
     gccccttccc cgaagcgcaa gttggcttgg acttgggaac aagctgagat cccaagcagc       240
     gacggaactc tctgctgggc tggcattaat acggctttgc cgaacaaact gattcgggcc       300
     ctgattgaag ccggtggact caaagaccag ctcggcccga tcaagaccat ccgcgccgaa       360
     gtgccctatg gcctcaatcg cagaagtcgc attgacttat tgcttacccc agacgacagc       420
     gcagacgatc aacgccccat ctacgtcgag gtgaaaaaca ccacctggag tcacggcgat       480
     gttgcgctct tcccagacac cgtcacggaa cggggccaaa aacacctgga ggaacttacg       540
     gcgctccttc ctgatgcacg aggtgttttg gttccctgcc tgagccgtcc ggatgtcatc       600
     gccttcgcac ccggggacag cgcagatccc cgctacgggg atctgttcag acaggccatg       660
     gcagcagggg ttgaagtgct gccttgctgc ttcagttttt atgaggacca gatccaatgg       720
     gagggagtca ggaccgtttg tcctcgcctg taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page