(data stored in SCRATCH3701 zone)

EMBL: CP000435.TGT

CP000435.TGT         Location/Qualifiers
FT   CDS_pept        complement(295010..296128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="sync_0284"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46127"
FT                   /db_xref="GOA:Q0IDF3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDF3"
FT                   /protein_id="ABI46127.1"
FT                   /translation="MFQFEIQATCSNTGARCGCFHTPHGPVTTPRFMPVGTLGTVKGVT
FT                   TSQLAETGAQMVLSNTYHLHLQPGEEIVADAGGLHRFMGWDGPMLTDSGGFQVFSLGDL
FT                   NRIDDEGVDFRNPRNGSRILLTPERSMQIQMRLGADVAMAFDQCPPYPATENDVAEACR
FT                   RTHAWLGRCADAHQRDDQALFGIVQGGCFPHLRDLSARTVASFNLPGIAIGGVSVGEPV
FT                   EEMHQIVRQVTPLLPADRPRYLMGIGTLREMAVAVANGIDMFDCVLPTRLGRHGTALVG
FT                   GERWNLRNARFRHDHTPLDPNCPCIACRQHTRAYLHHLIRSEELLGLTLLSIHNLTHLI
FT                   RFTTAMGQAIRDGCFSEDFAPWEPSSRAHHTW"
     gtgttccaat tcgagattca ggccacttgc agcaacacgg gtgctcgctg tggatgcttc        60
     cacacacctc atggtccagt cacaacaccg cggtttatgc ccgtaggcac actgggcacc       120
     gtgaaagggg tgaccacctc ccagttggcg gagaccggcg cccaaatggt gctgtccaac       180
     acgtatcacc tgcatctcca gcctggggag gagatcgttg ccgacgccgg agggctacat       240
     cggttcatgg gctgggacgg tccgatgctc accgattccg gtggctttca ggtgttcagc       300
     ctcggcgacc tcaatcgcat tgacgatgaa ggagtggact tccgcaaccc tcgaaacggc       360
     agccgaattt tgctgacccc cgaaaggtcg atgcagatcc aaatgcgcct tggcgccgat       420
     gtggccatgg ccttcgatca atgtccgccc tatccagcca ccgagaacga tgtcgcggag       480
     gcctgtcggc gtacgcacgc ctggttaggc cgctgcgcag acgcccatca acgcgacgat       540
     caagccctct ttgggattgt gcaaggaggc tgtttccccc acctccgcga tctcagcgcg       600
     cgaacggtgg cgagcttcaa cctgcccggc atcgctatcg gcggcgtcag cgttggagaa       660
     ccggtggagg agatgcatca gatcgtgcgc caggtcacac ccctgttacc cgctgatcgc       720
     ccccgatatc tgatgggcat tggcacgctg cgtgagatgg cagttgccgt ggccaacggg       780
     attgacatgt ttgattgcgt cctgcctaca cgcctaggca ggcatggcac ggcactggtt       840
     gggggcgagc gctggaacct gcgcaacgct cgttttcggc acgaccacac ccctttagat       900
     ccaaactgcc catgcatcgc ttgccgccag cacacccgtg cctacctgca tcatctgatc       960
     cgtagcgagg agctgctcgg cctcacgctc ttaagcatcc ataacctcac ccacttgatc      1020
     cgattcacca ccgccatggg gcaagcaatt cgtgatggtt gcttttcaga ggatttcgct      1080
     ccgtgggagc caagctcaag agcccatcac acgtggtag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page