(data stored in SCRATCH3701 zone)

EMBL: CP000435.THIC

CP000435.THIC        Location/Qualifiers
FT   CDS_pept        135289..136686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="sync_0129"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47377"
FT                   /db_xref="GOA:Q0IDV6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDV6"
FT                   /protein_id="ABI47377.1"
FT                   /translation="MRTEWVSARKGQANVSQMHYARKGVVTEEMAYVAKIENLPESLVM
FT                   EEVARGRMIIPANVNHTNLEPMAIGIASKCKVNANIGASPNASDAAEEVNKLKLAVKYG
FT                   ADTVMDLSTGGVNLDEVRTSIIGASSVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEK
FT                   HCQQGVDYQTIHAGLLIEHLPKVKGRLTGIVSRGGGILAQWMLYHHRQNPLFTRFDDIC
FT                   EIFKRYDCTFSLGDSLRPGCQHDASDAAQLAELKTLGDLTRRAWKHDVQVMVEGPGHVP
FT                   LDQIEFNVKKQMEECNEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTP
FT                   KEHLGLPNAEDVREGLIAYKIAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSL
FT                   DPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDADLDGLEQVLKSQGAAELV
FT                   GVKQDKL"
     atgcgtactg aatgggtttc cgctcgcaag ggccaggcca atgtgtctca gatgcattac        60
     gcccgtaagg gtgtggtgac ggaagagatg gcctatgtag ccaagatcga gaaccttccg       120
     gaatcccttg tgatggaaga ggtagcaagg ggtcggatga tcattcccgc caatgtcaat       180
     cacaccaatc tggagccgat ggcgattggc attgccagca aatgcaaggt gaacgccaac       240
     attggtgcgt ctcccaatgc ctcggatgca gcagaggagg tgaacaagct gaagttggcc       300
     gtgaaatatg gcgccgacac cgtgatggat ctgtccaccg gtggcgtcaa cctcgatgaa       360
     gtgcgtacat cgattattgg ggcgtcatcc gtgccaatcg gcacggtgcc tgtgtatcag       420
     gccttggaaa gtgtgcacgg ctcgatcgag aaactcgatg aagatgattt cctgcacatc       480
     atcgaaaagc attgccaaca gggcgttgat taccagacga ttcacgctgg cctgttgatc       540
     gagcatctcc ccaaggtgaa gggacgccta acgggaattg tgagccgtgg aggcgggatc       600
     ttggcgcagt ggatgttgta tcaccaccgc caaaatcctt tgttcacgcg cttcgacgat       660
     atttgtgaaa tttttaagcg ctacgactgc accttctcct tgggagattc attgcgtcct       720
     ggctgccagc acgatgcctc cgatgctgcg cagcttgctg aactgaagac cttgggagat       780
     ctcaccaggc gggcttggaa gcacgatgtt caggtgatgg ttgagggtcc aggccatgtg       840
     cccttggacc agatcgagtt caacgtgaag aagcagatgg aagagtgcaa tgaggcgcct       900
     ttctatgtgc tcggcccatt ggtgaccgat atcgcccctg gctatgacca catcacttca       960
     gcgatcggcg ctgcaatggc gggctggcat ggcaccgcga tgctttgcta tgtgacgcct      1020
     aaggagcacc ttggtcttcc taatgcggag gatgtacgcg agggactcat tgcctacaag      1080
     attgcagccc atgcggctga tattgcccgt catcgcccag gtgcgaggga tcgcgatgat      1140
     gagctcagcc gcgctcgtta tgccttcgat tggaacaagc agtttgagtt gtctttagat      1200
     ccagagcggg cgaaggagta tcacgacgaa actctgccag cagacatcta caagcaagca      1260
     gagttttgtt cgatgtgtgg acccaagcat tgcccgatgc aaaccaagat cacggatgcg      1320
     gatttggacg gactcgagca agtgcttaag tcccagggtg ctgcggaatt ggttggcgtg      1380
     aaacaggaca aactctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page