(data stored in SCRATCH3701 zone)

EMBL: CP000435.THYX

CP000435.THYX        Location/Qualifiers
FT   CDS_pept        complement(328007..328732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="sync_0320"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="identified by match to protein family HMM PF02511;
FT                   match to protein family HMM TIGR02170"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46029"
FT                   /db_xref="GOA:Q0IDB8"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB8"
FT                   /protein_id="ABI46029.1"
FT                   /translation="MDSRFRVDLIAATPNPQQCVYVGMHQDYSEGFVAADREQWPDETR
FT                   AGEICVKRLLAGERGHYGPMEHAQIVLNVGWFPHSVMQQARTHRVGVSFDVQSMRYTGD
FT                   RICRAAVGELDLEEVFYLRPVGEYSDRKGKKYLYSEAERQKDLNHCKISADRYQELLQA
FT                   GYAEEHARGILPFDYRQHFVVSFTLRAFLHFMDLRAKLDAQQEIRELCDLMWPHLKTWT
FT                   PEFAGWYEKTRLHRARLAP"
     atggactctc gttttcgagt tgatctgatc gccgcaaccc cgaatccgca acagtgcgtg        60
     tacgtgggta tgcaccagga ctacagcgaa ggcttcgtgg ccgccgatcg cgagcaatgg       120
     cccgatgaga ccagagccgg cgaaatatgt gtcaaacgcc ttctcgcagg agagcggggt       180
     cattacggac ccatggagca tgcccagatt gtgttgaacg tgggctggtt tcctcattcc       240
     gtgatgcaac aggctcggac gcaccgggtg ggcgtcagtt ttgatgttca atccatgcgc       300
     tatacaggcg atcgcatctg cagggcagca gttggagaac tcgatctcga agaggtgttt       360
     tatttgcgcc ccgttggtga atacagcgac cgcaagggca agaaatacct ctacagcgag       420
     gctgagcggc aaaaagattt aaaccactgc aaaatcagcg ccgatcgcta tcaggaattg       480
     cttcaggccg gctatgccga ggaacatgcc cgcggcatcc tcccctttga ttacaggcaa       540
     catttcgtgg tgagcttcac gctcagggcc ttcctgcatt tcatggatct acgcgcaaag       600
     ctcgatgccc agcaggaaat ccgcgagctc tgcgatctca tgtggcccca cctcaaaacg       660
     tggacgccag aatttgcggg ttggtacgaa aaaacaagat tgcacagagc tcggcttgct       720
     ccctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page