(data stored in SCRATCH3701 zone)

EMBL: CP000435.TKT

CP000435.TKT         Location/Qualifiers
FT   CDS_pept        complement(136863..138872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="sync_0130"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45379"
FT                   /db_xref="GOA:Q0IDV5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV5"
FT                   /protein_id="ABI45379.1"
FT                   /translation="MAAATASLDTLCVNSIRMLAVDAVNKSNSGHPGLPMGCAPMGYTL
FT                   WDKFLKHNPKNPKWFNRDRFVLSAGHGCMLQYALLHLTGYDSVTIDDIKQFRQWGSKTP
FT                   GHPETFETPGIEVTTGPLGAGISNAVGLAIAESHLGAKFNKADAKVVDHFTYVIMGDGC
FT                   NQEGVASEAASLAGHLKLGKLIALYDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVA
FT                   DGDTDVNAIAKAIEAAKAVTNKPSIIKVTTTIGYGSPNKSDTAGVHGAPLGAEEAELTR
FT                   KQLGWTHGPFEIPQEAYDQYRQAVERGASQEAEWNQSLANYRSKYPTESAEFERMLRGE
FT                   LPQGWDKDLPTYTPDDKGLATRKHSQICLGALGANLPELIGGSADLTHSNYTDIAGETG
FT                   SYQPETPEKRYLHFGVREHAMAAVLNGIAYHNSGLIPYGGTFLVFADYMRGSMRLSALS
FT                   MLGVIYVLTHDSIGVGEDGPTHQPIETIPSLRAMPGMLVFRPGDGNETSGAYKLAIENR
FT                   NRPSAMCLSRQGMANQANSSIDKVAFGGYILEDCAGTPDLILIGTGTELDLCVQAAKQL
FT                   TSEGKNVRVVSMPCVELYDEQSDAYKEEVLPNAVRKRIVVEAAETFGWHRFIGLDGDSI
FT                   TMNRFGASAPGGTCMEKFGFTVDNVVAKSKALLG"
     atggccgccg caaccgcttc tctcgatacg ctctgcgtca acagcatccg catgctggcc        60
     gttgatgccg tcaataaatc caatagcggt caccccggtt tgcccatggg ctgcgcaccg       120
     atggggtaca cgttgtggga caagtttctc aagcacaacc ccaaaaaccc aaagtggttc       180
     aatcgggatc ggtttgtgct gtcagccggc catggctgca tgctgcagta cgccctcctg       240
     cacctcaccg gctacgactc cgtaaccatc gacgacatca aacaattccg gcagtggggc       300
     tcgaaaacgc caggacatcc ggaaacattt gaaacccctg ggatcgaagt caccaccggg       360
     ccccttggcg caggaatctc caatgccgtg ggtctggcca ttgccgaatc acacctgggc       420
     gccaaattca acaaggctga cgccaaagtt gtggaccact tcacctacgt gatcatgggt       480
     gatggctgca atcaggaagg cgtggcttca gaagctgcct ccctggccgg ccacctcaaa       540
     ttgggcaaat tgattgccct ctatgacgac aatcacatca ccattgatgg gcgaactgat       600
     gtgtcgttca ccgaggacgt tctcaagcgt tacgaagcct atggctggca cgtacaacac       660
     gtggccgacg gagacaccga cgtgaacgcg atcgccaagg cgattgaggc cgcgaaagcc       720
     gtcaccaaca agccttcgat catcaaggtg accaccacca ttggttacgg ctcacccaac       780
     aagagtgata cggctggtgt ccatggcgcc ccgcttggag cagaggaagc tgagctcaca       840
     cgcaagcaat tgggctggac ccacggccca ttcgaaattc ctcaagaggc ctacgaccag       900
     taccgccagg cggtggagcg cggcgcttcc caggaagctg agtggaatca gtctttggcg       960
     aactaccgca gcaaataccc cacagaatct gcagaatttg agcgcatgct gcggggcgaa      1020
     ctcccccagg gctgggacaa agatctgcct acttacaccc cagacgacaa aggtctggcc      1080
     acacgcaaac attcccagat ctgtcttgga gcgctaggcg ccaacctgcc cgaattgatc      1140
     ggcggctctg ctgacctcac ccactccaac tacaccgaca tcgccggaga aactggctct      1200
     taccagcccg aaacccctga aaagcgctac ctccacttcg gtgtacgcga gcacgcgatg      1260
     gcggcagtac tcaatggcat cgcttatcac aacagcggcc tgatccccta cggcggcacc      1320
     ttccttgtgt ttgccgatta catgcgcggt tccatgcgct tatctgcact gagcatgctt      1380
     ggtgtgattt acgtgctaac ccacgattcc atcggtgttg gcgaagacgg ccccacccac      1440
     cagccgatcg aaaccatccc atcgctccgc gccatgcctg gaatgctggt gttccgtcct      1500
     ggcgacggca atgaaaccag tggtgcctac aagcttgcaa tcgaaaatcg caaccgcccc      1560
     agcgcgatgt gcctcagccg tcaggggatg gcgaatcaag ccaactcttc gatcgacaaa      1620
     gtggcattcg gcggttacat ccttgaagac tgtgcaggca cacccgatct gattttgatc      1680
     ggtacaggca ccgaacttga cctctgcgtg caagctgcca aacagctgac ctcagaaggc      1740
     aaaaatgtgc gcgtcgtctc catgccttgc gttgagctct acgacgagca aagcgatgct      1800
     tacaaagaag aagtgctccc caacgctgtt cgtaagcgga tcgtggtgga agccgctgaa      1860
     acctttggct ggcatcgttt cattggtctc gatggcgaca gcatcaccat gaatcgcttc      1920
     ggcgcctccg ctccaggcgg cacctgcatg gagaagttcg gcttcaccgt cgacaacgtg      1980
     gttgcgaagt caaaggctct actgggctga                                       2010
//

If you have problems or comments...

PBIL Back to PBIL home page