(data stored in SCRATCH3701 zone)

EMBL: CP000435.TRMB

CP000435.TRMB        Location/Qualifiers
FT   CDS_pept        complement(335886..336599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="sync_0328"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47587"
FT                   /db_xref="GOA:Q0IDB0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDB0"
FT                   /protein_id="ABI47587.1"
FT                   /translation="MRQHVNPLSRFFQLPLELPAPHELFEHPNLPIHLDIGCARGFFLL
FT                   ELAAMQPERNHLGVEIRRPLVQAAQHDRDRQEQHNLHFLFCNANISLEAWMAALPPDQL
FT                   QLVSIQFPDPWFKQRHRKRRVLQPALLLAIAAALHPGRHLFLQSDVLAVIEPMVALVEL
FT                   SNCFARPKDDPQPWRSSNPLPVATERERYVQEQGQPTYRVLFERTQAELPALRDLEMAW
FT                   QQVDNSKDAAPTPHG"
     atgcgccagc acgtcaatcc cctcagccgc ttctttcagt tgccgctgga actcccggcg        60
     ccgcatgagc tgtttgagca tcccaacctg ccgatccatc tcgatattgg ttgcgctcga       120
     ggcttttttc tgttggagct ggcggcgatg cagcccgagc gcaaccatct cggagttgag       180
     atccgccggc ctttggtgca agccgcccaa cacgatcgcg accggcagga acagcacaac       240
     cttcattttt tattttgcaa cgccaatatc agccttgagg cttggatggc agcgttgccg       300
     ccagaccagt tgcagctagt aagcattcaa ttcccagatc cctggttcaa acaacgccat       360
     cgcaaacgtc gagtgctgca acccgccctc ttgcttgcca tcgctgcagc actccatccc       420
     ggccgacacc tgtttctgca aagtgatgtg ttggcagtga tcgaaccgat ggtggccctc       480
     gtggaactct ccaactgctt tgcgcgcccg aaagacgatc cacagccttg gcgatccagt       540
     aatcccttgc ccgtagcaac ggaacgggag cgctacgtcc aggaacaggg acaacccacc       600
     tatcgcgtgc tgtttgagcg cacccaggct gagcttccag cattaaggga tctggagatg       660
     gcttggcaac aggttgataa ttccaaagac gctgcaccca cacctcatgg ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page