(data stored in SCRATCH3701 zone)

EMBL: CP000435.TYRA

CP000435.TYRA        Location/Qualifiers
FT   CDS_pept        443913..444791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="sync_0447"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF02153;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF02737; match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45874"
FT                   /db_xref="GOA:Q0ICZ6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ6"
FT                   /protein_id="ABI45874.1"
FT                   /translation="MDQGQVAQPWSIDRVGVVGMGLIGGSIALDLTQQGVEVHGLVHRE
FT                   VTAQRARSRGLASLISTDPSCLHDCDLVILALPLESLLSPAESLLKALPEQAVVTDVGS
FT                   VKAEVLAVWRDLHPRFVGSHPMAGTAQAGVDAGLTGLFRDRPWVATPESSTDPSALEVI
FT                   HQLAVRLGSHWLTADAARHDQAVALISHLPVIVSAALLRAVGEERDPAVLDLARTLASS
FT                   GFADTSRVGGGNPALGTAMASRNTQAVLRSLAAYRWSLEQLEEAILEGHWAQLEKELER
FT                   TQLLRPQFLSD"
     atggatcagg ggcaagtggc gcagccgtgg tcgatcgatc gtgttggcgt ggtgggcatg        60
     gggttgattg gtggttcgat cgctcttgac ctcacccaac aaggggttga ggtgcatggc       120
     ctggttcacc gtgaagtcac agcgcaaaga gcccgcagca gagggcttgc ttcattgatc       180
     agtacggatc ccagctgtct tcatgattgt gatctggtga tccttgccct ccctttggag       240
     tcattgctct cgccagcaga gagcctgctg aaggctcttc ctgagcaggc ggtggtcact       300
     gacgtggggt ctgtcaaggc agaggttctg gcagtttggc gtgatcttca tccgcgcttt       360
     gtggggagtc atcccatggc gggaacggct caggcagggg ttgatgctgg cctgacggga       420
     ctttttcgtg accgtccctg ggtggcgaca cctgagtcgt cgacggatcc ttcagcgctt       480
     gaagtgatcc atcagctagc cgtgcgcctt ggtagccatt ggcttacagc tgatgcggcg       540
     cgtcatgacc aggccgtggc gctgatctct catctcccag tcatcgtcag tgccgccctg       600
     ttgcgagcgg taggggaaga gcgtgatcct gccgtgctcg atcttgcgag aaccttggca       660
     tcgagtggct ttgccgatac cagccgagtg gggggcggca acccggctct cgggactgca       720
     atggcgtcac gcaacactca agctgtgctt cgctccttag cggcgtatcg ctggagtttg       780
     gagcagctcg aggaagcgat tcttgagggg cattgggctc agcttgagaa agagctggaa       840
     agaacgcagt tgctaagacc acagtttctg tcggattag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page