(data stored in SCRATCH3701 zone)

EMBL: CP000435.UVRB

CP000435.UVRB        Location/Qualifiers
FT   CDS_pept        76950..78989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="sync_0074"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45036"
FT                   /db_xref="GOA:Q0IE10"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE10"
FT                   /protein_id="ABI45036.1"
FT                   /translation="MPAYELSAPYTPKGDQPTAISKLVEGVNGGERYQTLLGATGTGKT
FT                   FTMANVIAQTGRPALVLAHNKTLAAQLCNELREFFPHNAVEYFISYYDYYQPEAYVPVS
FT                   DTYIAKTASINEEIDMLRHSATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVPFKVG
FT                   ETLNLRGSLRDLVNNQYSRNDTEAGRGRFRVKGDVLEIGPAYDDRLVRVELFGDEVEAI
FT                   RYVDPTTGEILQSLDAISIYPAKHFVTPKERLNDAVKAIRSELKERLEFLNGEGKLLEA
FT                   QRLEQRATYDLEMLQQIGYCNGVENYARHLAGREPGSAPECLIDYFPDDWLLIVDESHV
FT                   TCSQLLAMYNGDQARKKVLIDHGFRLPSAADNRPLKSEEFWSKAKQTVFVSATPGNWEM
FT                   EVSEGQVAEQVIRPTGVLDPLVEVRPTTGQVDDLLGEIRDRASKKQRVLVTTLTKRMAE
FT                   DLTDYLAENKVRVRYLHSEIHSIERIEIIQDLRLGEYDVLVGVNLLREGLDLPEVSLVA
FT                   ILDADKEGFLRAQRSLIQTIGRAARHVEGKALLYAETMTDSMAKAIEETERRRKIQHTY
FT                   NEKHGITPTAAGKKASNSILSFLELSRKLKADGPDADLVKVAGKAVQALEEDVDGLALD
FT                   ALPELIDQLELKMKESAKKLDFEEAANLRDRIKKLRQKLVGSSR"
     atgcccgcct acgagctatc ggcgccttac acgcccaagg gagatcaacc aacggcgatc        60
     tccaaactgg tggagggtgt gaatggtgga gagcgttatc aaacgcttct aggagccacg       120
     ggtactggca agacgttcac gatggccaat gtgatcgccc aaaccggacg tccggccttg       180
     gtgttggccc acaacaaaac attggcggcc cagctttgta atgagctccg ggagttcttt       240
     cctcacaacg ctgtcgaata tttcatctcc tattacgact attaccagcc ggaagcctac       300
     gttccggtaa gtgataccta catcgccaaa acagcatcga tcaacgaaga gattgacatg       360
     ctgcgtcatt ctgcgacgcg ctctttattt gagcgccgtg atgtgatcgt ggtggcttcg       420
     attagttgta tttatgggct aggaattcca agtgaatacc tcaaggcggc tgtgccattc       480
     aaggttggtg agaccttgaa tttgcgagga tctctgcgcg atttggtgaa caatcagtac       540
     agccgtaatg acacagaagc cggaagagga cgcttccgcg ttaagggtga tgtgctggaa       600
     attgggccgg cctatgacga ccgcctagtg cgtgttgagc tcttcggcga tgaggtggaa       660
     gcaattcgct atgtagatcc aaccaccggc gaaatcctcc aaagtttgga tgcgatcagt       720
     atctacccgg ccaagcactt tgtgacgcca aaagagcgtc ttaatgatgc ggtgaaagcg       780
     attcgtagtg agcttaaaga gcgacttgag tttttgaacg gagagggcaa gttgctcgaa       840
     gctcagcgtt tagaacaacg cgctacttat gacttggaga tgctgcagca aattggatat       900
     tgcaatggag ttgagaacta tgcccgtcat ttggctggtc gagaacctgg atccgcacct       960
     gaatgtttaa ttgattattt tccggatgat tggttgttga tcgtggatga aagccacgtg      1020
     acctgctctc aacttctagc gatgtacaac ggcgatcaag cacgtaaaaa ggtactgatt      1080
     gatcacggct tccgtttgcc cagtgcggct gataatcggc cgcttaaatc ggaggagttc      1140
     tggagtaaag ccaagcaaac cgtgttcgtg agtgccaccc ctggaaactg ggagatggag      1200
     gtcagtgagg ggcaagtggc agaacaggtg attcgcccta cgggtgtgct ggatccgctt      1260
     gtggaggtgc gccccaccac tggacaggtg gatgatttgc ttggcgagat ccgtgatcgt      1320
     gcgtccaaga agcagcgggt gttggtgaca acgctcacca agcgtatggc ggaagatcta      1380
     acggactacc tggcagaaaa taaagttcga gtgcgttatt tgcactcaga gattcactcc      1440
     attgagcgaa tcgagatcat tcaggatttg cgtctaggtg aatacgacgt acttgttggc      1500
     gtgaatttgc ttcgggaagg attggatctc cctgaagttt ctttggtggc gattctggat      1560
     gccgacaagg aaggcttcct gcgcgcccag cgctccttga ttcagaccat cggacgagca      1620
     gcacggcatg tggaaggcaa agcgttgctt tatgccgaga ccatgactga ctccatggcg      1680
     aaggcgattg aagaaaccga gcgccgccgc aagatccagc acacctacaa cgaaaagcac      1740
     ggcattacgc ccactgctgc aggtaagaaa gccagcaatt cgattttgag ttttctcgaa      1800
     ctgtctcgca agctcaaagc tgatggccca gatgccgacc tggtgaaggt ggccggaaaa      1860
     gcggtccagg ctttagagga agatgtcgat ggcttggcgc tcgacgccct gcctgagctc      1920
     atcgatcaac ttgagctgaa gatgaaggag tcagccaaga agctcgactt tgaagaagcg      1980
     gccaacctgc gggatcgaat caagaagttg cgacagaaac tggtggggag cagcagatga      2040
//

If you have problems or comments...

PBIL Back to PBIL home page