(data stored in SCRATCH3701 zone)

EMBL: CP000435.WCAG-1

CP000435.WCAG-1      Location/Qualifiers
FT   CDS_pept        complement(39804..40733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaG-1"
FT                   /locus_tag="sync_0035"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45796"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE48"
FT                   /protein_id="ABI45796.1"
FT                   /translation="MLNDLVNRCAPLPSGATLCILGAGFSGGHLAKLSKALGTRVICTS
FT                   RRPESGSDHLPFDSAKGIVPGHEVLASVTHLISTIPPTKEGADPVLSCLGEQLQQLPLQ
FT                   WVGYFSTTGVYGNSNGNWVNETNEPQPTQLRSQKRLDCEQLWRKSGLPVQILRLPGIYG
FT                   PGRSPLAAVRSGEVTPVDQPGQMFCRIHVDDLAGACWHLMHRAAAGQRPTVVNISDNRP
FT                   ASRLELQRFAAELLGCKLPAPIPFSEAQATMSPMALSFWADNRKVSNALLRDELGYTFL
FT                   HPDYSSGLKDCFEAEGFNAMNPEPEAEP"
     atgctgaacg atcttgtcaa ccgctgcgct cctctcccgt cgggcgccac gttgtgcatt        60
     cttggagctg gattcagcgg tggccatctc gccaagctgt ccaaagcgct tgggacaaga       120
     gtgatctgca cgagccgccg accggaatcc ggcagcgatc atctgccctt tgacagcgcc       180
     aaagggatcg tgcccggcca cgaagtactc gcctccgtca cccatctgat cagcacaatc       240
     ccacccacca aagagggagc ggatccagtg ctgtcgtgtc ttggagagca gctgcagcag       300
     cttccactcc aatgggtggg ctatttctcc accaccggcg tctacggaaa tagcaatggc       360
     aactgggtga atgaaaccaa cgagccccaa cccactcaac tccgcagcca gaagcgattg       420
     gactgtgagc agctctggcg caaaagcggc ctgccggtgc agatcctgcg cttaccgggg       480
     atctatgggc caggccgctc ccctttggct gccgtccgct caggcgaagt cactcctgtg       540
     gatcaaccag ggcagatgtt ttgccgaatc cacgtggatg acctagctgg agcctgctgg       600
     catctcatgc atcgagccgc agcaggacag cgaccaacag tggtgaacat cagtgataac       660
     aggcccgcct cccgcctcga gcttcaacgt tttgccgccg aactcttggg atgcaaactc       720
     ccagcaccga tccccttcag tgaagcccaa gccaccatga gcccaatggc tctctccttc       780
     tgggcagaca accgcaaagt gagcaacgca ctcctgcgag acgaactggg ctacaccttt       840
     ctgcatccgg attattcaag cggtctcaag gattgtttcg aggctgaagg cttcaacgcg       900
     atgaatcctg aacccgaggc ggagccttaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page