(data stored in SCRATCH3701 zone)

EMBL: CP000435.WCAG-2

CP000435.WCAG-2      Location/Qualifiers
FT   CDS_pept        complement(150622..151629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaG-2"
FT                   /locus_tag="sync_0145"
FT                   /product="GDP-L-fucose synthetase"
FT                   /EC_number="1.1.1.271"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45123"
FT                   /db_xref="GOA:Q0IDU0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU0"
FT                   /protein_id="ABI45123.1"
FT                   /translation="MIKADDRFFVAGARGMAGSAICRALQENGYGDETKGGALLTPTRQ
FT                   ELDLLNHEVVKAWYEENKPDVVVLAAAKVGGIYANDTYPADFLLENLKIQTNVIEGAWK
FT                   AGVRRLLFLGSSCIYPKFAEQPIKEEALLTGSLEPTNEWYAIAKITGIKLCESLRQQYG
FT                   FDAISLMPTNLYGPGDNYHPENSHVLPALIRRFHEAKQAGAKSVTCWGTGSPLREFLHV
FT                   DDLGNACVFALENWSALDQDAPKDDQGKPLAFLNLGTGVDLTIQELAEQIAAVVGFEGT
FT                   IEWDTSKPDGTPKKQLDVSLMKQLNWSASIPIREGLCLVYEDFIKEGLSQNLRN"
     ttgatcaaag cggacgatcg tttttttgtt gcaggagcaa ggggcatggc gggcagcgcg        60
     atctgccggg cgttgcaaga gaatggctat ggcgatgaaa cgaaaggcgg agccttactg       120
     acgccaacgc gccaggagct ggacctgctc aatcacgaag tagtgaaggc ttggtacgaa       180
     gaaaacaagc cagatgtggt ggtgctggca gccgccaagg tgggcggaat ttatgccaat       240
     gacacctatc cagccgattt cttgttggag aacctcaaga tccaaacgaa tgtgattgaa       300
     ggtgcttgga aagcgggggt gcggcgattg ctctttctgg gtagtagttg tatttacccg       360
     aagtttgccg agcaaccgat caaagaagaa gcgttattga caggatcatt ggagcccacg       420
     aatgagtggt atgcgatcgc caagattacg gggatcaagc tgtgcgaatc gttgagacaa       480
     cagtatggat ttgatgcgat cagcttgatg ccaacgaatt tgtatggccc tggagataac       540
     tatcacccgg aaaatagcca tgtgctgcca gcgctcatcc gccgctttca tgaagccaag       600
     caagctgggg caaaaagtgt gacgtgttgg ggaacgggat caccgctgcg tgagtttttg       660
     catgtggatg atctgggtaa tgcctgcgtg tttgcgctgg aaaactggag cgctcttgat       720
     caagatgcac caaaagatga tcaagggaaa ccgctggcgt ttttgaatct gggaacggga       780
     gtggatctaa cgattcagga gttagcggaa cagatcgcag cagtcgttgg gtttgaagga       840
     acgattgagt gggacacaag taagccggat ggaacaccaa agaaacaact tgatgtcagc       900
     ttgatgaagc agctaaactg gagtgcgagc atccctataa gggaaggatt gtgtttggtc       960
     tacgaggatt tcattaagga aggattgtcg cagaatttgc gtaattaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page