(data stored in SCRATCH3701 zone)

EMBL: CP000435.WECD

CP000435.WECD        Location/Qualifiers
FT   CDS_pept        complement(88284..88739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="sync_0084"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45302"
FT                   /db_xref="GOA:Q0IE01"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE01"
FT                   /protein_id="ABI45302.1"
FT                   /translation="MARIRLVQHAAGAPGLRWFGLGPDLKPSRSLLKLRRLLHKHAFWA
FT                   QQRNTADLKRMLAGSRVVVSLWRGKRMVGFGRATSDGIHRAVLWDVVVAGDLQGRGLGR
FT                   RVVEALLSAKAIRNAERVYLMTTNSSGFYQQLGFEPASTQQLLIRKQ"
     atggctcgca tccgactcgt gcaacatgcc gccggcgccc caggcctgag atggtttgga        60
     ctgggccctg atctcaagcc aagccgcagc ctgctcaagc tgcgtcgctt gctacacaaa       120
     catgcgttct gggcgcaaca gcgcaacaca gcagatctca aacggatgct ggcgggcagc       180
     agggttgtag tgagcctttg gcggggcaag cgaatggtgg ggttcggacg agccaccagc       240
     gatggaatcc atcgcgccgt gctttgggat gtggtcgttg ccggagacct tcaaggccgc       300
     ggactcggca ggagggtcgt ggaagccctg ctcagcgcta aagccattcg caacgccgag       360
     cgcgtgtatc tgatgaccac caacagttcc gggttttacc aacagttggg gtttgaacca       420
     gccagcactc agcaattgct gatccgcaag caatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page