(data stored in ACNUC7421 zone)

EMBL: CP000438

ID   CP000438; SV 1; circular; genomic DNA; STD; PRO; 6537648 BP.
XX
AC   CP000438; AABQ07000000-AABQ07000005;
XX
PR   Project:PRJNA386;
XX
DT   07-OCT-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Pseudomonas aeruginosa UCBPP-PA14, complete genome.
XX
KW   .
XX
OS   Pseudomonas aeruginosa UCBPP-PA14
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-6537648
RX   DOI; 10.1186/gb-2006-7-10-r90.
RX   PUBMED; 17038190.
RA   Lee D.G., Urbach J.M., Wu G., Liberati N.T., Feinbaum R.L., Miyata S.,
RA   Diggins L.T., He J., Saucier M., Deziel E., Friedman L., Li L., Grills G.,
RA   Montgomery K., Kucherlapati R., Rahme L.G., Ausubel F.M.;
RT   "Genomic analysis reveals that Pseudomonas aeruginosa virulence is
RT   combinatorial";
RL   Genome Biol. 7(10):R90-R90(2006).
XX
RN   [2]
RP   1-6537648
RA   Lee D.G., Urbach J.M., Wu G., Liberati N.T., Feinbaum R., Miyata S.,
RA   Diggins L.T., He J., Saucier M., Deziel E., Friedman L., Li L., Grills G.,
RA   Montgomery K., Kucherlapati R., Rahme L.G., Ausubel F.M.;
RT   ;
RL   Submitted (18-AUG-2006) to the INSDC.
RL   Department of Molecular Biology, Massachusetts General Hospital, Richard B.
RL   Simches Research Center, 185 Cambridge Street, 7th Floor, Boston, MA 02114,
RL   USA
XX
DR   MD5; 2eaaefd7695b4e35be94203e1ed11b60.
DR   BioSample; SAMN02603591.
DR   EnsemblGenomes-Gn; EBG00001225014.
DR   EnsemblGenomes-Gn; EBG00001225015.
DR   EnsemblGenomes-Gn; EBG00001225016.
DR   EnsemblGenomes-Gn; EBG00001225017.
DR   EnsemblGenomes-Gn; EBG00001225018.
DR   EnsemblGenomes-Gn; EBG00001225019.
DR   EnsemblGenomes-Gn; EBG00001225020.
DR   EnsemblGenomes-Gn; EBG00001225021.
DR   EnsemblGenomes-Gn; EBG00001225022.
DR   EnsemblGenomes-Gn; EBG00001225023.
DR   EnsemblGenomes-Gn; EBG00001225024.
DR   EnsemblGenomes-Gn; EBG00001225025.
DR   EnsemblGenomes-Gn; EBG00001225026.
DR   EnsemblGenomes-Gn; EBG00001225027.
DR   EnsemblGenomes-Gn; EBG00001225028.
DR   EnsemblGenomes-Gn; EBG00001225029.
DR   EnsemblGenomes-Gn; EBG00001225030.
DR   EnsemblGenomes-Gn; EBG00001225031.
DR   EnsemblGenomes-Gn; EBG00001225032.
DR   EnsemblGenomes-Gn; EBG00001225033.
DR   EnsemblGenomes-Gn; EBG00001225034.
DR   EnsemblGenomes-Gn; EBG00001225035.
DR   EnsemblGenomes-Gn; EBG00001225036.
DR   EnsemblGenomes-Gn; EBG00001225037.
DR   EnsemblGenomes-Gn; EBG00001225038.
DR   EnsemblGenomes-Gn; EBG00001225039.
DR   EnsemblGenomes-Gn; EBG00001225040.
DR   EnsemblGenomes-Gn; EBG00001225041.
DR   EnsemblGenomes-Gn; EBG00001225042.
DR   EnsemblGenomes-Gn; EBG00001225043.
DR   EnsemblGenomes-Gn; EBG00001225044.
DR   EnsemblGenomes-Gn; EBG00001225045.
DR   EnsemblGenomes-Gn; EBG00001225046.
DR   EnsemblGenomes-Gn; EBG00001225047.
DR   EnsemblGenomes-Gn; EBG00001225048.
DR   EnsemblGenomes-Gn; EBG00001225049.
DR   EnsemblGenomes-Gn; EBG00001225050.
DR   EnsemblGenomes-Gn; EBG00001225051.
DR   EnsemblGenomes-Gn; EBG00001225052.
DR   EnsemblGenomes-Gn; EBG00001225053.
DR   EnsemblGenomes-Gn; EBG00001225054.
DR   EnsemblGenomes-Gn; EBG00001225055.
DR   EnsemblGenomes-Gn; EBG00001225056.
DR   EnsemblGenomes-Gn; EBG00001225057.
DR   EnsemblGenomes-Gn; EBG00001225058.
DR   EnsemblGenomes-Gn; EBG00001225059.
DR   EnsemblGenomes-Gn; EBG00001225060.
DR   EnsemblGenomes-Gn; EBG00001225061.
DR   EnsemblGenomes-Gn; EBG00001225062.
DR   EnsemblGenomes-Gn; EBG00001225063.
DR   EnsemblGenomes-Gn; EBG00001225064.
DR   EnsemblGenomes-Gn; EBG00001225065.
DR   EnsemblGenomes-Gn; EBG00001225066.
DR   EnsemblGenomes-Gn; EBG00001225067.
DR   EnsemblGenomes-Gn; EBG00001225068.
DR   EnsemblGenomes-Gn; EBG00001225069.
DR   EnsemblGenomes-Gn; EBG00001225070.
DR   EnsemblGenomes-Gn; EBG00001225071.
DR   EnsemblGenomes-Gn; EBG00001225072.
DR   EnsemblGenomes-Gn; EBG00001225073.
DR   EnsemblGenomes-Gn; EBG00001225074.
DR   EnsemblGenomes-Gn; EBG00001225075.
DR   EnsemblGenomes-Gn; EBG00001225076.
DR   EnsemblGenomes-Gn; EBG00001225077.
DR   EnsemblGenomes-Gn; EBG00001225078.
DR   EnsemblGenomes-Gn; EBG00001225079.
DR   EnsemblGenomes-Gn; EBG00001225080.
DR   EnsemblGenomes-Gn; EBG00001225081.
DR   EnsemblGenomes-Gn; EBG00001225082.
DR   EnsemblGenomes-Gn; EBG00001225083.
DR   EnsemblGenomes-Gn; EBG00001225084.
DR   EnsemblGenomes-Gn; EBG00001225085.
DR   EnsemblGenomes-Gn; EBG00001225086.
DR   EnsemblGenomes-Gn; EBG00001225087.
DR   EnsemblGenomes-Gn; EBG00001225088.
DR   EnsemblGenomes-Gn; EBG00001225089.
DR   EnsemblGenomes-Gn; EBG00001225090.
DR   EnsemblGenomes-Gn; EBG00001225091.
DR   EnsemblGenomes-Gn; EBG00001225092.
DR   EnsemblGenomes-Gn; EBG00001225093.
DR   EnsemblGenomes-Gn; EBG00001225094.
DR   EnsemblGenomes-Gn; EBG00001225095.
DR   EnsemblGenomes-Gn; EBG00001225096.
DR   EnsemblGenomes-Gn; EBG00001225097.
DR   EnsemblGenomes-Gn; EBG00001225098.
DR   EnsemblGenomes-Gn; EBG00001225099.
DR   EnsemblGenomes-Gn; EBG00001225100.
DR   EnsemblGenomes-Gn; EBG00001225101.
DR   EnsemblGenomes-Gn; EBG00001225102.
DR   EnsemblGenomes-Gn; EBG00001225103.
DR   EnsemblGenomes-Gn; EBG00001225104.
DR   EnsemblGenomes-Gn; EBG00001225105.
DR   EnsemblGenomes-Gn; EBG00001225106.
DR   EnsemblGenomes-Gn; EBG00001225107.
DR   EnsemblGenomes-Gn; EBG00001225108.
DR   EnsemblGenomes-Gn; EBG00001225109.
DR   EnsemblGenomes-Gn; EBG00001225110.
DR   EnsemblGenomes-Gn; EBG00001225111.
DR   EnsemblGenomes-Gn; EBG00001225112.
DR   EnsemblGenomes-Gn; EBG00001225113.
DR   EnsemblGenomes-Gn; EBG00001225114.
DR   EnsemblGenomes-Gn; EBG00001225115.
DR   EnsemblGenomes-Gn; EBG00001225116.
DR   EnsemblGenomes-Gn; EBG00001225117.
DR   EnsemblGenomes-Gn; EBG00001225118.
DR   EnsemblGenomes-Gn; EBG00001225119.
DR   EnsemblGenomes-Gn; EBG00001225120.
DR   EnsemblGenomes-Gn; EBG00001225121.
DR   EnsemblGenomes-Gn; EBG00001225122.
DR   EnsemblGenomes-Gn; EBG00001225123.
DR   EnsemblGenomes-Gn; EBG00001225124.
DR   EnsemblGenomes-Gn; EBG00001225125.
DR   EnsemblGenomes-Gn; EBG00001225126.
DR   EnsemblGenomes-Gn; EBG00001225127.
DR   EnsemblGenomes-Gn; EBG00001225128.
DR   EnsemblGenomes-Gn; EBG00001225129.
DR   EnsemblGenomes-Gn; EBG00001225130.
DR   EnsemblGenomes-Gn; EBG00001225131.
DR   EnsemblGenomes-Gn; EBG00001225132.
DR   EnsemblGenomes-Gn; EBG00001225133.
DR   EnsemblGenomes-Gn; EBG00001225134.
DR   EnsemblGenomes-Gn; EBG00001225135.
DR   EnsemblGenomes-Gn; EBG00001225136.
DR   EnsemblGenomes-Gn; EBG00001225137.
DR   EnsemblGenomes-Gn; EBG00001225138.
DR   EnsemblGenomes-Gn; EBG00001225139.
DR   EnsemblGenomes-Gn; EBG00001225140.
DR   EnsemblGenomes-Gn; EBG00001225141.
DR   EnsemblGenomes-Gn; EBG00001225142.
DR   EnsemblGenomes-Gn; EBG00001225143.
DR   EnsemblGenomes-Gn; EBG00001225144.
DR   EnsemblGenomes-Gn; EBG00001225145.
DR   EnsemblGenomes-Gn; EBG00001225146.
DR   EnsemblGenomes-Gn; EBG00001225147.
DR   EnsemblGenomes-Gn; EBG00001225148.
DR   EnsemblGenomes-Gn; EBG00001225149.
DR   EnsemblGenomes-Gn; EBG00001225150.
DR   EnsemblGenomes-Gn; EBG00001225151.
DR   EnsemblGenomes-Gn; EBG00001225152.
DR   EnsemblGenomes-Gn; EBG00001225153.
DR   EnsemblGenomes-Gn; EBG00001225154.
DR   EnsemblGenomes-Gn; EBG00001225155.
DR   EnsemblGenomes-Gn; EBG00001225156.
DR   EnsemblGenomes-Gn; EBG00001225157.
DR   EnsemblGenomes-Gn; EBG00001225158.
DR   EnsemblGenomes-Gn; EBG00001225159.
DR   EnsemblGenomes-Gn; EBG00001225160.
DR   EnsemblGenomes-Gn; EBG00001225161.
DR   EnsemblGenomes-Gn; EBG00001225162.
DR   EnsemblGenomes-Gn; EBG00001225163.
DR   EnsemblGenomes-Gn; EBG00001225164.
DR   EnsemblGenomes-Gn; EBG00001225165.
DR   EnsemblGenomes-Gn; EBG00001225166.
DR   EnsemblGenomes-Gn; EBG00001225167.
DR   EnsemblGenomes-Gn; EBG00001225168.
DR   EnsemblGenomes-Gn; EBG00001225169.
DR   EnsemblGenomes-Gn; EBG00001225170.
DR   EnsemblGenomes-Gn; EBG00001225171.
DR   EnsemblGenomes-Gn; EBG00001225172.
DR   EnsemblGenomes-Gn; EBG00001225173.
DR   EnsemblGenomes-Gn; EBG00001225174.
DR   EnsemblGenomes-Gn; EBG00001225175.
DR   EnsemblGenomes-Gn; EBG00001225176.
DR   EnsemblGenomes-Gn; EBG00001225177.
DR   EnsemblGenomes-Gn; EBG00001225178.
DR   EnsemblGenomes-Gn; PA14_03410.
DR   EnsemblGenomes-Gn; PA14_06875.
DR   EnsemblGenomes-Gn; PA14_07470.
DR   EnsemblGenomes-Gn; PA14_08570.
DR   EnsemblGenomes-Gn; PA14_08580.
DR   EnsemblGenomes-Gn; PA14_08590.
DR   EnsemblGenomes-Gn; PA14_08600.
DR   EnsemblGenomes-Gn; PA14_08610.
DR   EnsemblGenomes-Gn; PA14_08650.
DR   EnsemblGenomes-Gn; PA14_08660.
DR   EnsemblGenomes-Gn; PA14_08670.
DR   EnsemblGenomes-Gn; PA14_08690.
DR   EnsemblGenomes-Gn; PA14_14570.
DR   EnsemblGenomes-Gn; PA14_20500.
DR   EnsemblGenomes-Gn; PA14_21800.
DR   EnsemblGenomes-Gn; PA14_21810.
DR   EnsemblGenomes-Gn; PA14_23490.
DR   EnsemblGenomes-Gn; PA14_23570.
DR   EnsemblGenomes-Gn; PA14_23580.
DR   EnsemblGenomes-Gn; PA14_24110.
DR   EnsemblGenomes-Gn; PA14_24120.
DR   EnsemblGenomes-Gn; PA14_24130.
DR   EnsemblGenomes-Gn; PA14_24870.
DR   EnsemblGenomes-Gn; PA14_27190.
DR   EnsemblGenomes-Gn; PA14_27600.
DR   EnsemblGenomes-Gn; PA14_27610.
DR   EnsemblGenomes-Gn; PA14_27620.
DR   EnsemblGenomes-Gn; PA14_28190.
DR   EnsemblGenomes-Gn; PA14_28740.
DR   EnsemblGenomes-Gn; PA14_30420.
DR   EnsemblGenomes-Gn; PA14_30680.
DR   EnsemblGenomes-Gn; PA14_30720.
DR   EnsemblGenomes-Gn; PA14_41200.
DR   EnsemblGenomes-Gn; PA14_41320.
DR   EnsemblGenomes-Gn; PA14_41330.
DR   EnsemblGenomes-Gn; PA14_41340.
DR   EnsemblGenomes-Gn; PA14_51230.
DR   EnsemblGenomes-Gn; PA14_51660.
DR   EnsemblGenomes-Gn; PA14_52320.
DR   EnsemblGenomes-Gn; PA14_52540.
DR   EnsemblGenomes-Gn; PA14_52550.
DR   EnsemblGenomes-Gn; PA14_52560.
DR   EnsemblGenomes-Gn; PA14_54840.
DR   EnsemblGenomes-Gn; PA14_55620.
DR   EnsemblGenomes-Gn; PA14_55631.
DR   EnsemblGenomes-Gn; PA14_55634.
DR   EnsemblGenomes-Gn; PA14_55635.
DR   EnsemblGenomes-Gn; PA14_55637.
DR   EnsemblGenomes-Gn; PA14_58710.
DR   EnsemblGenomes-Gn; PA14_60150.
DR   EnsemblGenomes-Gn; PA14_60160.
DR   EnsemblGenomes-Gn; PA14_60180.
DR   EnsemblGenomes-Gn; PA14_60620.
DR   EnsemblGenomes-Gn; PA14_61760.
DR   EnsemblGenomes-Gn; PA14_61830.
DR   EnsemblGenomes-Gn; PA14_62050.
DR   EnsemblGenomes-Gn; PA14_62060.
DR   EnsemblGenomes-Gn; PA14_62070.
DR   EnsemblGenomes-Gn; PA14_62080.
DR   EnsemblGenomes-Gn; PA14_62090.
DR   EnsemblGenomes-Gn; PA14_62790.
DR   EnsemblGenomes-Gn; PA14_62800.
DR   EnsemblGenomes-Gn; PA14_63460.
DR   EnsemblGenomes-Gn; PA14_65210.
DR   EnsemblGenomes-Gn; PA14_65220.
DR   EnsemblGenomes-Gn; PA14_68030.
DR   EnsemblGenomes-Gn; PA14_68150.
DR   EnsemblGenomes-Gn; PA14_70870.
DR   EnsemblGenomes-Gn; PA14_70880.
DR   EnsemblGenomes-Gn; PA14_70890.
DR   EnsemblGenomes-Gn; PA14_70900.
DR   EnsemblGenomes-Gn; PA14_70910.
DR   EnsemblGenomes-Tr; EBT00001793337.
DR   EnsemblGenomes-Tr; EBT00001793339.
DR   EnsemblGenomes-Tr; EBT00001793341.
DR   EnsemblGenomes-Tr; EBT00001793343.
DR   EnsemblGenomes-Tr; EBT00001793345.
DR   EnsemblGenomes-Tr; EBT00001793349.
DR   EnsemblGenomes-Tr; EBT00001793350.
DR   EnsemblGenomes-Tr; EBT00001793351.
DR   EnsemblGenomes-Tr; EBT00001793353.
DR   EnsemblGenomes-Tr; EBT00001793355.
DR   EnsemblGenomes-Tr; EBT00001793356.
DR   EnsemblGenomes-Tr; EBT00001793358.
DR   EnsemblGenomes-Tr; EBT00001793363.
DR   EnsemblGenomes-Tr; EBT00001793364.
DR   EnsemblGenomes-Tr; EBT00001793365.
DR   EnsemblGenomes-Tr; EBT00001793368.
DR   EnsemblGenomes-Tr; EBT00001793370.
DR   EnsemblGenomes-Tr; EBT00001793372.
DR   EnsemblGenomes-Tr; EBT00001793374.
DR   EnsemblGenomes-Tr; EBT00001793375.
DR   EnsemblGenomes-Tr; EBT00001793376.
DR   EnsemblGenomes-Tr; EBT00001793377.
DR   EnsemblGenomes-Tr; EBT00001793378.
DR   EnsemblGenomes-Tr; EBT00001793379.
DR   EnsemblGenomes-Tr; EBT00001793380.
DR   EnsemblGenomes-Tr; EBT00001793381.
DR   EnsemblGenomes-Tr; EBT00001793382.
DR   EnsemblGenomes-Tr; EBT00001793383.
DR   EnsemblGenomes-Tr; EBT00001793384.
DR   EnsemblGenomes-Tr; EBT00001793385.
DR   EnsemblGenomes-Tr; EBT00001793386.
DR   EnsemblGenomes-Tr; EBT00001793387.
DR   EnsemblGenomes-Tr; EBT00001793388.
DR   EnsemblGenomes-Tr; EBT00001793389.
DR   EnsemblGenomes-Tr; EBT00001793390.
DR   EnsemblGenomes-Tr; EBT00001793391.
DR   EnsemblGenomes-Tr; EBT00001793392.
DR   EnsemblGenomes-Tr; EBT00001793393.
DR   EnsemblGenomes-Tr; EBT00001793394.
DR   EnsemblGenomes-Tr; EBT00001793395.
DR   EnsemblGenomes-Tr; EBT00001793396.
DR   EnsemblGenomes-Tr; EBT00001793397.
DR   EnsemblGenomes-Tr; EBT00001793398.
DR   EnsemblGenomes-Tr; EBT00001793399.
DR   EnsemblGenomes-Tr; EBT00001793400.
DR   EnsemblGenomes-Tr; EBT00001793401.
DR   EnsemblGenomes-Tr; EBT00001793402.
DR   EnsemblGenomes-Tr; EBT00001793403.
DR   EnsemblGenomes-Tr; EBT00001793404.
DR   EnsemblGenomes-Tr; EBT00001793405.
DR   EnsemblGenomes-Tr; EBT00001793406.
DR   EnsemblGenomes-Tr; EBT00001793407.
DR   EnsemblGenomes-Tr; EBT00001793408.
DR   EnsemblGenomes-Tr; EBT00001793409.
DR   EnsemblGenomes-Tr; EBT00001793410.
DR   EnsemblGenomes-Tr; EBT00001793411.
DR   EnsemblGenomes-Tr; EBT00001793412.
DR   EnsemblGenomes-Tr; EBT00001793413.
DR   EnsemblGenomes-Tr; EBT00001793414.
DR   EnsemblGenomes-Tr; EBT00001793415.
DR   EnsemblGenomes-Tr; EBT00001793416.
DR   EnsemblGenomes-Tr; EBT00001793417.
DR   EnsemblGenomes-Tr; EBT00001793418.
DR   EnsemblGenomes-Tr; EBT00001793419.
DR   EnsemblGenomes-Tr; EBT00001793420.
DR   EnsemblGenomes-Tr; EBT00001793421.
DR   EnsemblGenomes-Tr; EBT00001793422.
DR   EnsemblGenomes-Tr; EBT00001793423.
DR   EnsemblGenomes-Tr; EBT00001793424.
DR   EnsemblGenomes-Tr; EBT00001793425.
DR   EnsemblGenomes-Tr; EBT00001793426.
DR   EnsemblGenomes-Tr; EBT00001793427.
DR   EnsemblGenomes-Tr; EBT00001793428.
DR   EnsemblGenomes-Tr; EBT00001793429.
DR   EnsemblGenomes-Tr; EBT00001793430.
DR   EnsemblGenomes-Tr; EBT00001793431.
DR   EnsemblGenomes-Tr; EBT00001793432.
DR   EnsemblGenomes-Tr; EBT00001793433.
DR   EnsemblGenomes-Tr; EBT00001793434.
DR   EnsemblGenomes-Tr; EBT00001793435.
DR   EnsemblGenomes-Tr; EBT00001793436.
DR   EnsemblGenomes-Tr; EBT00001793437.
DR   EnsemblGenomes-Tr; EBT00001793438.
DR   EnsemblGenomes-Tr; EBT00001793439.
DR   EnsemblGenomes-Tr; EBT00001793440.
DR   EnsemblGenomes-Tr; EBT00001793441.
DR   EnsemblGenomes-Tr; EBT00001793442.
DR   EnsemblGenomes-Tr; EBT00001793443.
DR   EnsemblGenomes-Tr; EBT00001793444.
DR   EnsemblGenomes-Tr; EBT00001793445.
DR   EnsemblGenomes-Tr; EBT00001793446.
DR   EnsemblGenomes-Tr; EBT00001793447.
DR   EnsemblGenomes-Tr; EBT00001793448.
DR   EnsemblGenomes-Tr; EBT00001793449.
DR   EnsemblGenomes-Tr; EBT00001793450.
DR   EnsemblGenomes-Tr; EBT00001793451.
DR   EnsemblGenomes-Tr; EBT00001793452.
DR   EnsemblGenomes-Tr; EBT00001793453.
DR   EnsemblGenomes-Tr; EBT00001793454.
DR   EnsemblGenomes-Tr; EBT00001793455.
DR   EnsemblGenomes-Tr; EBT00001793456.
DR   EnsemblGenomes-Tr; EBT00001793457.
DR   EnsemblGenomes-Tr; EBT00001793458.
DR   EnsemblGenomes-Tr; EBT00001793459.
DR   EnsemblGenomes-Tr; EBT00001793460.
DR   EnsemblGenomes-Tr; EBT00001793461.
DR   EnsemblGenomes-Tr; EBT00001793462.
DR   EnsemblGenomes-Tr; EBT00001793463.
DR   EnsemblGenomes-Tr; EBT00001793464.
DR   EnsemblGenomes-Tr; EBT00001793465.
DR   EnsemblGenomes-Tr; EBT00001793466.
DR   EnsemblGenomes-Tr; EBT00001793467.
DR   EnsemblGenomes-Tr; EBT00001793468.
DR   EnsemblGenomes-Tr; EBT00001793469.
DR   EnsemblGenomes-Tr; EBT00001793470.
DR   EnsemblGenomes-Tr; EBT00001793471.
DR   EnsemblGenomes-Tr; EBT00001793472.
DR   EnsemblGenomes-Tr; EBT00001793473.
DR   EnsemblGenomes-Tr; EBT00001793474.
DR   EnsemblGenomes-Tr; EBT00001793475.
DR   EnsemblGenomes-Tr; EBT00001793476.
DR   EnsemblGenomes-Tr; EBT00001793477.
DR   EnsemblGenomes-Tr; EBT00001793478.
DR   EnsemblGenomes-Tr; EBT00001793479.
DR   EnsemblGenomes-Tr; EBT00001793480.
DR   EnsemblGenomes-Tr; EBT00001793481.
DR   EnsemblGenomes-Tr; EBT00001793482.
DR   EnsemblGenomes-Tr; EBT00001793483.
DR   EnsemblGenomes-Tr; EBT00001793484.
DR   EnsemblGenomes-Tr; EBT00001793485.
DR   EnsemblGenomes-Tr; EBT00001793486.
DR   EnsemblGenomes-Tr; EBT00001793487.
DR   EnsemblGenomes-Tr; EBT00001793488.
DR   EnsemblGenomes-Tr; EBT00001793489.
DR   EnsemblGenomes-Tr; EBT00001793490.
DR   EnsemblGenomes-Tr; EBT00001793491.
DR   EnsemblGenomes-Tr; EBT00001793492.
DR   EnsemblGenomes-Tr; EBT00001793493.
DR   EnsemblGenomes-Tr; EBT00001793494.
DR   EnsemblGenomes-Tr; EBT00001793495.
DR   EnsemblGenomes-Tr; EBT00001793496.
DR   EnsemblGenomes-Tr; EBT00001793497.
DR   EnsemblGenomes-Tr; EBT00001793498.
DR   EnsemblGenomes-Tr; EBT00001793499.
DR   EnsemblGenomes-Tr; EBT00001793500.
DR   EnsemblGenomes-Tr; EBT00001793501.
DR   EnsemblGenomes-Tr; EBT00001793502.
DR   EnsemblGenomes-Tr; EBT00001793503.
DR   EnsemblGenomes-Tr; EBT00001793504.
DR   EnsemblGenomes-Tr; EBT00001793505.
DR   EnsemblGenomes-Tr; EBT00001793506.
DR   EnsemblGenomes-Tr; EBT00001793507.
DR   EnsemblGenomes-Tr; EBT00001793508.
DR   EnsemblGenomes-Tr; EBT00001793509.
DR   EnsemblGenomes-Tr; EBT00001793510.
DR   EnsemblGenomes-Tr; EBT00001793511.
DR   EnsemblGenomes-Tr; EBT00001793512.
DR   EnsemblGenomes-Tr; EBT00001793513.
DR   EnsemblGenomes-Tr; EBT00001793514.
DR   EnsemblGenomes-Tr; EBT00001793515.
DR   EnsemblGenomes-Tr; EBT00001793516.
DR   EnsemblGenomes-Tr; EBT00001793517.
DR   EnsemblGenomes-Tr; EBT00001793518.
DR   EnsemblGenomes-Tr; EBT00001793519.
DR   EnsemblGenomes-Tr; EBT00001793520.
DR   EnsemblGenomes-Tr; PA14_03410-1.
DR   EnsemblGenomes-Tr; PA14_06875-1.
DR   EnsemblGenomes-Tr; PA14_07470-1.
DR   EnsemblGenomes-Tr; PA14_08570-1.
DR   EnsemblGenomes-Tr; PA14_08580-1.
DR   EnsemblGenomes-Tr; PA14_08590-1.
DR   EnsemblGenomes-Tr; PA14_08600-1.
DR   EnsemblGenomes-Tr; PA14_08610-1.
DR   EnsemblGenomes-Tr; PA14_08650-1.
DR   EnsemblGenomes-Tr; PA14_08660-1.
DR   EnsemblGenomes-Tr; PA14_08670-1.
DR   EnsemblGenomes-Tr; PA14_08690-1.
DR   EnsemblGenomes-Tr; PA14_14570-1.
DR   EnsemblGenomes-Tr; PA14_20500-1.
DR   EnsemblGenomes-Tr; PA14_21800-1.
DR   EnsemblGenomes-Tr; PA14_21810-1.
DR   EnsemblGenomes-Tr; PA14_23490-1.
DR   EnsemblGenomes-Tr; PA14_23570-1.
DR   EnsemblGenomes-Tr; PA14_23580-1.
DR   EnsemblGenomes-Tr; PA14_24110-1.
DR   EnsemblGenomes-Tr; PA14_24120-1.
DR   EnsemblGenomes-Tr; PA14_24130-1.
DR   EnsemblGenomes-Tr; PA14_24870-1.
DR   EnsemblGenomes-Tr; PA14_27190-1.
DR   EnsemblGenomes-Tr; PA14_27600-1.
DR   EnsemblGenomes-Tr; PA14_27610-1.
DR   EnsemblGenomes-Tr; PA14_27620-1.
DR   EnsemblGenomes-Tr; PA14_28190-1.
DR   EnsemblGenomes-Tr; PA14_28740-1.
DR   EnsemblGenomes-Tr; PA14_30420-1.
DR   EnsemblGenomes-Tr; PA14_30680-1.
DR   EnsemblGenomes-Tr; PA14_30720-1.
DR   EnsemblGenomes-Tr; PA14_41200-1.
DR   EnsemblGenomes-Tr; PA14_41320-1.
DR   EnsemblGenomes-Tr; PA14_41330-1.
DR   EnsemblGenomes-Tr; PA14_41340-1.
DR   EnsemblGenomes-Tr; PA14_51230-1.
DR   EnsemblGenomes-Tr; PA14_51660-1.
DR   EnsemblGenomes-Tr; PA14_52320-1.
DR   EnsemblGenomes-Tr; PA14_52540-1.
DR   EnsemblGenomes-Tr; PA14_52550-1.
DR   EnsemblGenomes-Tr; PA14_52560-1.
DR   EnsemblGenomes-Tr; PA14_54840-1.
DR   EnsemblGenomes-Tr; PA14_55620-1.
DR   EnsemblGenomes-Tr; PA14_55631-1.
DR   EnsemblGenomes-Tr; PA14_55634-1.
DR   EnsemblGenomes-Tr; PA14_55635-1.
DR   EnsemblGenomes-Tr; PA14_55637-1.
DR   EnsemblGenomes-Tr; PA14_58710-1.
DR   EnsemblGenomes-Tr; PA14_60150-1.
DR   EnsemblGenomes-Tr; PA14_60160-1.
DR   EnsemblGenomes-Tr; PA14_60180-1.
DR   EnsemblGenomes-Tr; PA14_60620-1.
DR   EnsemblGenomes-Tr; PA14_61760-1.
DR   EnsemblGenomes-Tr; PA14_61830-1.
DR   EnsemblGenomes-Tr; PA14_62050-1.
DR   EnsemblGenomes-Tr; PA14_62060-1.
DR   EnsemblGenomes-Tr; PA14_62070-1.
DR   EnsemblGenomes-Tr; PA14_62080-1.
DR   EnsemblGenomes-Tr; PA14_62090-1.
DR   EnsemblGenomes-Tr; PA14_62790-1.
DR   EnsemblGenomes-Tr; PA14_62800-1.
DR   EnsemblGenomes-Tr; PA14_63460-1.
DR   EnsemblGenomes-Tr; PA14_65210-1.
DR   EnsemblGenomes-Tr; PA14_65220-1.
DR   EnsemblGenomes-Tr; PA14_68030-1.
DR   EnsemblGenomes-Tr; PA14_68150-1.
DR   EnsemblGenomes-Tr; PA14_70870-1.
DR   EnsemblGenomes-Tr; PA14_70880-1.
DR   EnsemblGenomes-Tr; PA14_70890-1.
DR   EnsemblGenomes-Tr; PA14_70900-1.
DR   EnsemblGenomes-Tr; PA14_70910-1.
DR   EuropePMC; PMC1794565; 17038190.
DR   EuropePMC; PMC1899365; 17194795.
DR   EuropePMC; PMC2293253; 18083816.
DR   EuropePMC; PMC2789088; 19941653.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC2830310; 20031220.
DR   EuropePMC; PMC3020527; 21115713.
DR   EuropePMC; PMC3067716; 21227987.
DR   EuropePMC; PMC3091783; 21108805.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3614170; 23545651.
DR   EuropePMC; PMC4066759; 24771344.
DR   EuropePMC; PMC4155085; 25168460.
DR   EuropePMC; PMC4288896; 25385800.
DR   EuropePMC; PMC4529145; 26252386.
DR   EuropePMC; PMC4821235; 26962050.
DR   EuropePMC; PMC5518991; 28574055.
DR   EuropePMC; PMC5527654; 28584154.
DR   EuropePMC; PMC5626926; 29033910.
DR   EuropePMC; PMC5666152; 29089424.
DR   EuropePMC; PMC5840502; 29229490.
DR   EuropePMC; PMC5850482; 28541480.
DR   EuropePMC; PMC5910555; 29678129.
DR   EuropePMC; PMC6220265; 30405166.
DR   EuropePMC; PMC6321873; 30383525.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01372; CRISPR-DR59.
DR   RFAM; RF01665; P13.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01672; P2.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01677; P35.
DR   RFAM; RF01678; P37.
DR   RFAM; RF01679; P36.
DR   RFAM; RF01680; P5.
DR   RFAM; RF01681; P4.
DR   RFAM; RF01682; P8.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000438.
DR   SILVA-SSU; CP000438.
XX
CC   Source DNA and bacteria available from Fred Ausubel at
CC   ausubel@molbio.mgh.harvard.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6537648
FT                   /organism="Pseudomonas aeruginosa UCBPP-PA14"
FT                   /strain="UCBPP-PA14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:208963"
FT   gene            483..2027
FT                   /gene="dnaA"
FT                   /locus_tag="PA14_00010"
FT   CDS_pept        483..2027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PA14_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14957"
FT                   /db_xref="GOA:Q02V80"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V80"
FT                   /protein_id="ABJ14957.1"
FT                   /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQTHVAPPPPVA
FT                   PPPAPVQPVSAAPVVVPREELPPVTTAPSVSSDPYEPEEPSIDPLAAAMPAGAAPAVRT
FT                   ERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLYGGVG
FT                   LGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLI
FT                   DDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVA
FT                   VEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGR
FT                   PITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
FT                   ALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLLRTLTT"
FT   gene            2056..3159
FT                   /gene="dnaN"
FT                   /locus_tag="PA14_00020"
FT   CDS_pept        2056..3159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PA14_00020"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14958"
FT                   /db_xref="GOA:A0A0H2ZIW1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIW1"
FT                   /protein_id="ABJ14958.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVN
FT                   GGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRG
FT                   IRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFI
FT                   LSDSNSSALVHEADNDDSAYVVMPMRL"
FT   gene            3169..4278
FT                   /gene="recF"
FT                   /locus_tag="PA14_00030"
FT   CDS_pept        3169..4278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PA14_00030"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14959"
FT                   /db_xref="GOA:Q02V78"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V78"
FT                   /protein_id="ABJ14959.1"
FT                   /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHL
FT                   LGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNAR
FT                   SAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRN
FT                   SWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSY
FT                   YRGWDKDRDLLEVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLK
FT                   DGWRTDTPVSMFHVEHGKVSQTTTIGSEA"
FT   gene            4275..6695
FT                   /gene="gyrB"
FT                   /locus_tag="PA14_00050"
FT   CDS_pept        4275..6695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PA14_00050"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14960"
FT                   /db_xref="GOA:A0A0H2ZJS1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS1"
FT                   /protein_id="ABJ14960.1"
FT                   /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVGETD
FT                   GSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFKYEGG
FT                   LKAFVEYLNTNKTAVNEVFHFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDASLHVNEHAPG
FT                   LSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLANESAMQGWLEKF
FT                   QARLTAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRDFFASNDYRSVSL
FT                   LGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQRYKGLGEMNPEQLW
FT                   ETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDV"
FT   gene            complement(7018..7791)
FT                   /locus_tag="PA14_00060"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0005"
FT   CDS_pept        complement(7018..7791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00060"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14961"
FT                   /db_xref="GOA:A0A0H2ZJX4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX4"
FT                   /protein_id="ABJ14961.1"
FT                   /translation="MSTVQAIRTVLFYLLLSASAFVWGTLSFFIAPILPFRARYRFVVQ
FT                   NWCRFAIWLTRVVAGIRYEVRGLENIPEKPCVILSKHQSTWETFFLSGFFEPLSQVLKR
FT                   ELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIPVGQ
FT                   MGKFSRGGTALAVNAGLPVLPIAHNAGQYWPKAGWAKYPGTIQVVIGPAMHAEGEGPRA
FT                   IAELNQRAEAWVSETMAEISPIQQRVSHPEPSVVS"
FT   gene            complement(7803..8339)
FT                   /locus_tag="PA14_00070"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0006"
FT   CDS_pept        complement(7803..8339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00070"
FT                   /product="putative histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14962"
FT                   /db_xref="GOA:A0A0H2ZK05"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK05"
FT                   /protein_id="ABJ14962.1"
FT                   /translation="MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSQAG
FT                   WTVAVATNQSGIARGYYDLAVLEAMHARLRELVAEQGGEVGLIVYCPHGPDDGCDCRKP
FT                   KPGMLRQIGKHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLPEGT
FT                   LIFDDLAAVASALLQ"
FT   gene            8671..10377
FT                   /locus_tag="PA14_00080"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0007"
FT   CDS_pept        8671..10377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14963"
FT                   /db_xref="GOA:A0A0H2ZJK8"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJK8"
FT                   /protein_id="ABJ14963.1"
FT                   /translation="MKRLKKTLHLSSLSLVSLALSSAALAAAPVMLDQGKEWTESHRQD
FT                   FYSRDQGSQVMPLPWLKALRQPDGTPFLADSLARYGYLPNPKAPAEGLPVGFTVAGTGA
FT                   RQMVGMTCSACHTRQIEVKGTAYRIDGGPAIVDFQAFLADLDRAVGPLTSDDAAFDAFA
FT                   KQILGANPPPGARDALLAAVKEWYEPYHTLIERALPKDTWGPARLDAVSMIFNRLTGLD
FT                   IGTAPPYLIPDNIKAADAPVRYPFLWNAARQNKTQWPGFAANGNDLLGLARNVGEVYGV
FT                   FATFHPQKSKFHLLGMDYLKVNSANFHGLGKLEELIKKIGPPKWPWAVDKHLARKGALI
FT                   FARKTDEGGCVECHGIRIKDLVLWDTPLRDVGSDSRQHAILDGQVQTGVMEGARMPFGQ
FT                   PLKATDEAFDVLAVAVAGSILQHFVPILGEKHDAKAAAVKPESVMTDETRQLLTAFQKP
FT                   VRTQADPYPYESRVLQGIWAAAPYLHNGSVPTLEELLKPAAERVESFPVGSAYDVDKVG
FT                   LAAQQTQFGSYVLKTTGCEQRASGNSRCGHEYGTSLSAEEKRALLEYLKVL"
FT   gene            complement(10434..12488)
FT                   /gene="glyS"
FT                   /locus_tag="PA14_00090"
FT   CDS_pept        complement(10434..12488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PA14_00090"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14964"
FT                   /db_xref="GOA:Q02V73"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V73"
FT                   /protein_id="ABJ14964.1"
FT                   /translation="MSAKDFLVELGTEELPPKALNSLGEAFLSGIEKGLKAAGLSYAAA
FT                   RFYAAPRRLAVLVEQLAVQQPDRTVNLDGPPLQAAFDASGNPTQAALGFAKKCGVDLQQ
FT                   IDKSGPKLRFSQTIAGQPAAGLLPGIVEASLNELPIPKRMRWAARREEFVRPTQWLVML
FT                   FGDDVVECEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAERRELIA
FT                   KRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDKKQPLESF
FT                   NERLRNVVFQAQLGTVFEKAQRVSGLAAYIAERIGGNAQNAARAGILSKCDLATEMVGE
FT                   FPEMQGIAGYYYATHGGEAEDVALALNEQYMPRGAGAELPSTLTGAAVAVADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVNAAVEQYGDKVKAAGLAE
FT                   QVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAFRQLPEAEALAA
FT                   ANKRVSNILAKSEDEVPPNVDASLLVEAAEKALGSAVANAESEVAPLAAARDYRAALAR
FT                   LAALREPVDTFFADVMVNVDDAAVRANRYALLAKLRGSFLGVADISLLG"
FT   gene            complement(12488..13435)
FT                   /gene="glyQ"
FT                   /locus_tag="PA14_00100"
FT   CDS_pept        complement(12488..13435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PA14_00100"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14965"
FT                   /db_xref="GOA:Q02V72"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V72"
FT                   /protein_id="ABJ14965.1"
FT                   /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSL
FT                   KAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLF
FT                   ELFDFYESEANRLIALELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   AVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
FT   gene            13540..14091
FT                   /gene="tag"
FT                   /locus_tag="PA14_00110"
FT   CDS_pept        13540..14091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PA14_00110"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14966"
FT                   /db_xref="GOA:A0A0H2ZIW5"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIW5"
FT                   /protein_id="ABJ14966.1"
FT                   /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGLS
FT                   WITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRAKLNAARQNAQAWLE
FT                   LDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYAFMQ
FT                   ASGMVMDHTQDCDRYAQLVG"
FT   gene            14236..15123
FT                   /locus_tag="PA14_00120"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0011"
FT   CDS_pept        14236..15123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00120"
FT                   /product="putative 2-OH-lauroyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14967"
FT                   /db_xref="GOA:A0A0H2ZJS7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS7"
FT                   /protein_id="ABJ14967.1"
FT                   /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREV
FT                   VRINLSKCFPELSETELEKLVGQSLMDIGRTLTESACAWIWPPEKSLRYIREVEGMEVL
FT                   EEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQLGNR
FT                   VAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGK
FT                   ARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSM
FT                   KRFKNRPDGEKKWY"
FT   gene            15208..15474
FT                   /locus_tag="PA14_00130"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0012"
FT   CDS_pept        15208..15474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14968"
FT                   /db_xref="GOA:A0A0H2ZJX8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX8"
FT                   /protein_id="ABJ14968.1"
FT                   /translation="MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVKHPDL
FT                   TQLPTGSVVTGQVQDLPIDAPILQMEVVRVDAEGVGLRFLSEA"
FT   gene            15621..16274
FT                   /locus_tag="PA14_00140"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0013"
FT   CDS_pept        15621..16274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00140"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14969"
FT                   /db_xref="GOA:A0A0H2ZK11"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK11"
FT                   /protein_id="ABJ14969.1"
FT                   /translation="MSASSPAAWRGTLAGLIAFHIVIIIASNYLVQLPITLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLLGKGPARLVIARVMIPALIASYVVSVLFQEAAFRGFSALLEF
FT                   NTFVARISLASFLAYVLGQILDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFFVAF
FT                   WRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPQSNA"
FT   gene            complement(16336..16608)
FT                   /locus_tag="PA14_00150"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0014"
FT   CDS_pept        complement(16336..16608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJL2"
FT                   /protein_id="ABJ14970.1"
FT                   /translation="MSKHERSVPSYVEYPYEQAILYVHRNASANEMLESVQERLRALLG
FT                   LLHALERIEVRTGQGVPIQRVAHILVTLGGDALTLLTAAHRATTS"
FT   gene            complement(16923..17240)
FT                   /locus_tag="PA14_00160"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0015"
FT   CDS_pept        complement(16923..17240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00160"
FT                   /product="putative tetratricopeptide repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14971"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIW8"
FT                   /protein_id="ABJ14971.1"
FT                   /translation="MMIEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCVE
FT                   QDPTYSAGWKLLGKARQAAGDLAGARQAWEQGLAAAATHGDKQAEKEMTVFLRKLDRAR
FT                   T"
FT   gene            complement(17389..18762)
FT                   /gene="trkA"
FT                   /locus_tag="PA14_00170"
FT   CDS_pept        complement(17389..18762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PA14_00170"
FT                   /product="potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14972"
FT                   /db_xref="GOA:A0A0H2ZJT5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT5"
FT                   /protein_id="ABJ14972.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREPAY
FT                   LTRTGLFDNEAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAYYGG
FT                   PLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIRAVMG
FT                   EMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDSTIVLNG
FT                   SASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSKVIGRSIN
FT                   EIKLPPGTTIGALVRDEEVLIAHGDTHIESGDHVLLFLVDKKYIRDVERLFQAGLTFF"
FT   gene            complement(18789..20093)
FT                   /gene="sun"
FT                   /locus_tag="PA14_00180"
FT   CDS_pept        complement(18789..20093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="PA14_00180"
FT                   /product="putative tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14973"
FT                   /db_xref="GOA:A0A0H2ZJY3"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY3"
FT                   /protein_id="ABJ14973.1"
FT                   /translation="MNPRLAACQALAAVLAGRASLSGALPPQLDKVAPRDRGLTQELAF
FT                   GAARWQPRLQALAARLLQKPFKAADTDIHALLLIGLYQLLYTRIPPHAAIGETVGCADK
FT                   LKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALKQAWPEQLDTLCA
FT                   ANNAHPPMTLRVNRRHGERDAYLAELAEAGIEARACDYSRDGIQLAAPRDVRELPGFAE
FT                   GRVSVQDEATQLAAELLESAPGQRVLDACCAPGGKTCHLLETQPGLAEVVAVDLEESRL
FT                   VRVRENLQRLGLQASLVAADARATGEWWDGKPFQRILLDAPCSATGVIRRHPDIKLARK
FT                   PEDIAALAHLQGELLDALWPTLEVGGVLLYATCSVMPAENSDSIAAFLARTPGARELDL
FT                   PGPWGMKQPHGRQLLPQVEGHDGFYYAKLIKISAR"
FT   gene            complement(20090..21034)
FT                   /gene="fmt"
FT                   /locus_tag="PA14_00190"
FT   CDS_pept        complement(20090..21034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PA14_00190"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14974"
FT                   /db_xref="GOA:Q02V63"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V63"
FT                   /protein_id="ABJ14974.1"
FT                   /translation="MSQALRIVFAGTPEFAAEHLKALLDTPHRIVAVYTQPDRPAGRGQ
FT                   KLMPSAVKSLALEHGLPVMQPQSLRNAEAQAELAALRADLMVVVAYGLILPQAVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMQMEAGLDTGPMLLKVSTPISAAD
FT                   TGGSLHDRLAALGPKAVVEAIAGLAAGTLHGEDQDDALATYAHKLNKDEARLDWSRPAV
FT                   ELERQVRAFTPWPVCHTSLADAPLKVLGASLGQGSGAPGTILEASRDGLLVACGEGALR
FT                   LTRLQVPGGKPLAFADLYNSRREQFATGQVLGQ"
FT   gene            complement(21088..21594)
FT                   /gene="def"
FT                   /locus_tag="PA14_00200"
FT   CDS_pept        complement(21088..21594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PA14_00200"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14975"
FT                   /db_xref="GOA:A0A0H2ZK18"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK18"
FT                   /protein_id="ABJ14975.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQ
FT                   HRQQA"
FT   gene            21733..22758
FT                   /locus_tag="PA14_00210"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0020"
FT   CDS_pept        21733..22758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00210"
FT                   /product="putative lysin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14976"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJL6"
FT                   /protein_id="ABJ14976.1"
FT                   /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISGK
FT                   FLRQPWKWPELWHANPQIQNPHLIYPGDTLSLVYVDGQPRLVLNRGESRGTIKLSPKIR
FT                   STPIAEAIPTIPLDKINSFLLANRIVDDEKTFTSAPYIVAGNAERIVSGTGDRIYARGK
FT                   FADGQPAYGIFRQGKVYIDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQEVRL
FT                   GDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGQRDGLAEGN
FT                   VLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYKKLSYALVLMASRPLSVTDRVQN
FT                   P"
FT   gene            22893..23981
FT                   /gene="smf"
FT                   /locus_tag="PA14_00230"
FT   CDS_pept        22893..23981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PA14_00230"
FT                   /product="putative Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14977"
FT                   /db_xref="GOA:A0A0H2ZIX1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX1"
FT                   /protein_id="ABJ14977.1"
FT                   /translation="MKNHSPAELEARLRLHGLPELGPMRFLRLIEAFGSASSALAAPAG
FT                   AWRTLGVPAEAAAARRSPAVREAAGEALRWLEGPRRHLLMWDDPGYPALLAEVADAPPL
FT                   LYVEGAPETLERPQLAMVGSRRASPAGLGTARSFARSLAQGGFAITSGLALGIDGAAHE
FT                   GALEVGGVTVAVLGTGLRRLYPRRHEALARRIVEGGGALVSELPLDSPPLPANFPRRNR
FT                   IISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDGALL
FT                   VESVGHVLEALRGWAQAEPAEAPAQPLPHPLLALLRAAPYTSEGLAAASGMTLPDVLAT
FT                   LSELELDGRVACEAGTWVHRSG"
FT   gene            24022..24579
FT                   /locus_tag="PA14_00240"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0022"
FT   CDS_pept        24022..24579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00240"
FT                   /product="putative translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14978"
FT                   /db_xref="GOA:Q02V59"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V59"
FT                   /protein_id="ABJ14978.1"
FT                   /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWVTG
FT                   VHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAILGGA
FT                   LGGRRNPSLIRDLVTGQVIRPA"
FT   gene            complement(24589..25566)
FT                   /gene="qor"
FT                   /locus_tag="PA14_00250"
FT   CDS_pept        complement(24589..25566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="PA14_00250"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14979"
FT                   /db_xref="GOA:A0A0H2ZJU1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU1"
FT                   /protein_id="ABJ14979.1"
FT                   /translation="MAKRIQFAAYGGPEVLEYRDYQPAEPGPREVRVRNRAIGLNFIDT
FT                   YYRSGLYPAPGFPSGLGSEGAGEVEAVGSEVTRFKVGDRVAYATGPLGAYSELHVLAEE
FT                   KLVHLPDGIDFEQAAAVMLKGLTTQYLLRQTYELRGGETILFHAAAGGVGLFACQWAKA
FT                   LGVQLIGTVSSPEKARLARQHGAWETIDYSHENVARRVLELTDGKKCPVVYDSVGKDTW
FT                   ETSLDCVAPRGLLVSFGNASGPVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMAD
FT                   ELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVLLP"
FT   gene            25757..26674
FT                   /gene="hemF"
FT                   /locus_tag="PA14_00280"
FT   CDS_pept        25757..26674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PA14_00280"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14980"
FT                   /db_xref="GOA:Q02V57"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V57"
FT                   /protein_id="ABJ14980.1"
FT                   /translation="MTDRIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGGG
FT                   RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVP
FT                   TSHANVRFFCAEKEGEEPVWWFGGGFDLTPYYAHEEDCVHWHRVARDACAPFGADVYPR
FT                   YKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIVQRRK
FT                   HTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKP
FT                   EPGSEEARLTEYFLADRDWLAGQP"
FT   gene            26732..27556
FT                   /gene="aroE"
FT                   /locus_tag="PA14_00290"
FT   CDS_pept        26732..27556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PA14_00290"
FT                   /product="shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14981"
FT                   /db_xref="GOA:A0A0H2ZJY6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY6"
FT                   /protein_id="ABJ14981.1"
FT                   /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGEALVYDAQLAPLDDFPG
FT                   FARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLIRLADGRLRGDNTDGAG
FT                   LLRDLTANAGVELRGKRVLLLGAGGAVRGVLEPFLGECPAELLIANRTARKAVDLAERF
FT                   ADLGAVRGCGFAEVEGPFDLVVNGTSASLAGDVPPLAQSVIEPGRTVCYDMMYAKEPTA
FT                   FNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATV"
FT   gene            27667..28653
FT                   /gene="plcB"
FT                   /locus_tag="PA14_00300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0026"
FT   CDS_pept        27667..28653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="PA14_00300"
FT                   /product="phospholipase C, PlcB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14982"
FT                   /db_xref="GOA:A0A0H2ZK23"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK23"
FT                   /protein_id="ABJ14982.1"
FT                   /translation="MKTFARLAAGLCICAIASQANAWSQPTHKNIVKDALAFMNSSYAT
FT                   EEMRQAYRFYVSAAGSEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASGIV
FT                   NYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKREDFDT
FT                   TEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLATYWFEQFRAAPSLQTIGYALHATGDVA
FT                   QPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQTGQVA
FT                   YARPEPLYDTSYETRLRVAKELIPESIALTVTVLTKGANSFDAQTAL"
FT   gene            28634..29920
FT                   /locus_tag="PA14_00310"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0027"
FT   CDS_pept        28634..29920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00310"
FT                   /product="putative peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14983"
FT                   /db_xref="GOA:A0A0H2ZJM0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJM0"
FT                   /protein_id="ABJ14983.1"
FT                   /translation="MHRLLSDRARGWRRALCGVAFGLLAWSAHGVPAKAPQDLRIDGEV
FT                   LPGKSVDLLEQALSRVKFNTDPQQLRRGLVENRLLARAVEDQLTAQSRADLDASVEIEA
FT                   GNLLEQVYGRRYREDLGPYLRQPRALSAERLREVLAPRSRGLVENSLLLDETQRREAAG
FT                   VELIGWQFPGQPAQVLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRIRRDYLWYRLA
FT                   RDGFGPAERQGVRTLVRDKLVRHRYLHQIGLYSDFHHESDALRELAGKVSDKDAEAYYR
FT                   RNLERYRNVAQVQAAHIRLADQASADKVYAELRNGLAFDEAVRRYSLADDRDRDPPGDL
FT                   GLIRPQDGRLDLLRKTALIQKADTVSQPMRIDGAFEIVRVRSREDRQLPLDDRSVRFEV
FT                   NQAVAREQLAAQFETRLRNLLAGARVEGL"
FT   gene            29917..30519
FT                   /locus_tag="PA14_00320"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0028"
FT   CDS_pept        29917..30519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX3"
FT                   /protein_id="ABJ14984.1"
FT                   /translation="MKRWLGVALGCSGLAIALACAGVLLAPADMAASSSSPPPARTVAA
FT                   LPAVDDRPPPLAPVRSQAVAPAYEAEPPAAELDREQAIQFMQMLRDEGDPRSPPLGGLQ
FT                   PRQGATAQELADPKQYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSAEEI
FT                   DEARAALGQLEMMRDKLQRESPQLLPGDSAPTSPAAP"
FT   gene            complement(30523..32076)
FT                   /locus_tag="PA14_00340"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0029"
FT   CDS_pept        complement(30523..32076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00340"
FT                   /product="putative sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14985"
FT                   /db_xref="GOA:A0A0H2ZJU7"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU7"
FT                   /protein_id="ABJ14985.1"
FT                   /translation="MWTRLLPFLAWLPGLRRGTLRREAWVGLNGAILALPQSMAYALIA
FT                   GLPAEYGLYAAMLPVAIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPLGSPQYVQAVL
FT                   LLTFLAGAFQWLLGVLRVGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLLGLAASGEGA
FT                   APGNGWRLLARFAEFDGPSLLVGGFSFALSLLVRRLRPRWPALLLGLLGGATLVWALPG
FT                   TFASVAHVQALSSALPGWNPLVFDSRSILDLLPAAVACGMLGLVTSLSIARALAARQGD
FT                   AFDANQEVRAQGLSNLLGPWLSASLSAGSFTRSGLNLEAGARSPLAGAFSALWVALLAV
FT                   LGARLIEHVPLPAMAAGILLIAWGLIDRPALRALYRSGRAECLVAGLTALATLLLPLQN
FT                   AIYAGVLASLFFYLRRTSTPRVLRQRNDEEEVLRIEGSIFFGACDYLQRLMRQCDRPRL
FT                   VLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQADEGCRLHYEG
FT                   "
FT   gene            complement(32081..33004)
FT                   /locus_tag="PA14_00360"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0030"
FT   CDS_pept        complement(32081..33004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00360"
FT                   /product="putative glycine betaine/L-proline ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14986"
FT                   /db_xref="GOA:A0A0H2ZJZ0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ0"
FT                   /protein_id="ABJ14986.1"
FT                   /translation="MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTNA
FT                   TAAFLLESLGYQVKIDTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVERL
FT                   ARNLDGTRFTLAVPRYVWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMIDAN
FT                   QFGLGDWKLVESSEQAMLAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQYFGD
FT                   RGQVYTLARKGYAAQCPNPARLLANLRFDLDMENRLMSDALEGTATPASATRAWLKANP
FT                   RVLEAWLQGVTSRDGGDALAAVRGQP"
FT   gene            complement(33021..34532)
FT                   /gene="betC"
FT                   /locus_tag="PA14_00380"
FT   CDS_pept        complement(33021..34532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="PA14_00380"
FT                   /product="choline sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14987"
FT                   /db_xref="GOA:A0A0H2ZK30"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK30"
FT                   /protein_id="ABJ14987.1"
FT                   /translation="MKTSPNILFIMADQMAAPLLPLHDPRSVLRMPHLSRLAERAVVFD
FT                   SAYCNSPLCAPSRFTLVSGRLPTRIGAWDNAADFAADTPTYAHYLRNLGYRTALSGKMH
FT                   FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQLDF
FT                   DEEVVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYSIPASYWNLYRDEDIPLPRQRF
FT                   AQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQIGALLATLEECGLA
FT                   DDTIVVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPARFAPRRIGASVSTVDLLP
FT                   TLVELAGGQVDPRLPLEGRSLLPHLRDGSGHDEVIGEYTAEGTLSPLMMIRRGDYKFIY
FT                   SEQDPCLLYDLRNDPQERENLAASPAHRGTFEAFLDEARRRWDIPAITRAVLDSQRRRR
FT                   LVAAALARGRLASWDHQPWIDASQQYMRNHIDLDDLERRARFPQP"
FT   gene            34645..35559
FT                   /locus_tag="PA14_00400"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0032"
FT   CDS_pept        34645..35559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00400"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14988"
FT                   /db_xref="GOA:A0A0H2ZJM3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJM3"
FT                   /protein_id="ABJ14988.1"
FT                   /translation="MGERLMPPSLDLLRVFESAARQLSFTAAAEELGTTQPAVSQQIKR
FT                   LEKELATPLFQRVHRGIVLTDAGQLLLRHVAAGLETIDAGIAALGARQRHEVLQVATDY
FT                   AFAAYWLMPRLPRFHQAHPHLDVSLVTSERGLAGQRGDIDVAILFGDGRSKHGEAHRLF
FT                   REEVFPVCSPRLVEGLQLPLAKAHLARLPMLHLKPAQHARWFDWPALFEALAIDRQPIP
FT                   AVLSFDNYTLLIQAAIAGQGVAIGWRHLVDGLLEQGLLCRPIGESCLSRYGYYAVLPER
FT                   KRRQRLVDGFVDWLQAELQAGGA"
FT   gene            35570..35947
FT                   /locus_tag="PA14_00410"
FT   CDS_pept        35570..35947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00410"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14989"
FT                   /db_xref="GOA:A0A0H2ZIX6"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX6"
FT                   /protein_id="ABJ14989.1"
FT                   /translation="MNEYSTPRIQGFHAHVYFDAQSIERARALCEEAARRFPLKMGRIH
FT                   ERPVGPHPDWSCQLAFAPEVFGELVPWLAIHRQDLVVFIHPVTGNDLLDHRDRAIWMGA
FT                   IRPLDLSILDEGPQRYDFAVP"
FT   gene            complement(35926..36291)
FT                   /locus_tag="PA14_00420"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0033"
FT   CDS_pept        complement(35926..36291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00420"
FT                   /product="putative histidine phosphotransfer domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14990"
FT                   /db_xref="GOA:A0A0H2ZJV3"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV3"
FT                   /protein_id="ABJ14990.1"
FT                   /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKLRRAQERE
FT                   QTQELNELAHRLAGMASLIHAHAVERACHQLEIACGESSVRKLADAVDDLVTALGELQC
FT                   ELHDWMTMTAPQGTAKS"
FT   gene            complement(36299..36922)
FT                   /gene="bvga"
FT                   /locus_tag="PA14_00430"
FT   CDS_pept        complement(36299..36922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvga"
FT                   /locus_tag="PA14_00430"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14991"
FT                   /db_xref="GOA:A0A0H2ZJZ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ4"
FT                   /protein_id="ABJ14991.1"
FT                   /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARKK
FT                   SPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSKR
FT                   ENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLANGNT
FT                   NKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
FT   gene            complement(37108..37914)
FT                   /gene="trpA"
FT                   /locus_tag="PA14_00440"
FT   CDS_pept        complement(37108..37914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PA14_00440"
FT                   /product="tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14992"
FT                   /db_xref="GOA:Q02V45"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V45"
FT                   /protein_id="ABJ14992.1"
FT                   /translation="MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFN
FT                   PIHHYGVERFIAEAKEVGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGDQRL
FT                   PTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAA
FT                   VARLADGVVVGSALIDRIAKARDNAQAVKDVLALCGELAEGVRNAR"
FT   gene            complement(37911..39119)
FT                   /gene="trpB"
FT                   /locus_tag="PA14_00450"
FT   CDS_pept        complement(37911..39119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PA14_00450"
FT                   /product="tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14993"
FT                   /db_xref="GOA:A0A0H2ZK36"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK36"
FT                   /protein_id="ABJ14993.1"
FT                   /translation="MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPA
FT                   FQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLA
FT                   RRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVI
FT                   PVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQL
FT                   AEKEGRLPNSLIACIGGGSNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGV
FT                   PGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALE
FT                   AFHTCCRLEGIIPALESSHALAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQE
FT                   SKA"
FT   gene            39223..40110
FT                   /gene="trpI"
FT                   /locus_tag="PA14_00460"
FT   CDS_pept        39223..40110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PA14_00460"
FT                   /product="trpBA operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14994"
FT                   /db_xref="GOA:A0A0H2ZJM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJM6"
FT                   /protein_id="ABJ14994.1"
FT                   /translation="MSRDLPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVRLLE
FT                   DDLGVALFGKDGRGVKLTDSGVRLRDACGDAFERLRGVCAELRRQTAEAPFVLGVPGSL
FT                   LARWFIPRLDRLNRALPDLRLQLSTSEGEFDPRRPGLDAMLWFAEPPWPADMQVFELAP
FT                   ERMGPVVSPRLAQETGLAQAPAARLLQEPLLHTASRPQAWPAWAASQGLAAEALRYGQG
FT                   FEHLYYLLEAAVAGLGVAIAPEALVRDDLAAGRLAAPWGFIETDARLALWVPARLHDPR
FT                   AGRLAHWLREQLAG"
FT   gene            40211..40426
FT                   /locus_tag="PA14_00470"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0038"
FT   CDS_pept        40211..40426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14995"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIY0"
FT                   /protein_id="ABJ14995.1"
FT                   /translation="MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVD
FT                   TRGHIENGAVGHYQVTLKVGFRIANS"
FT   gene            40610..40837
FT                   /locus_tag="PA14_00480"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0039"
FT   CDS_pept        40610..40837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14996"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV9"
FT                   /protein_id="ABJ14996.1"
FT                   /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAYT
FT                   LEIVDKGSVTDKKVVGTCDGGTKEIVYQRG"
FT   gene            41133..42821
FT                   /locus_tag="PA14_00490"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0040"
FT   CDS_pept        41133..42821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00490"
FT                   /product="putative hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14997"
FT                   /db_xref="GOA:A0A0H2ZJZ8"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ8"
FT                   /protein_id="ABJ14997.1"
FT                   /translation="MALHRLAFIFLCLPLMASAAPFTSPGDRDLIRDRQQRLLDEQRKR
FT                   LEELQQLPGKGAPAAADASGDDERCFEIRRIEMEGAGHLGESARRQLLAPYQGRCLGVG
FT                   QLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRIIVVEGRLEGLDSSALASPRELA
FT                   MSFPGRTGELLDLRELEQLVDQLSRLPSRQAQLELVPGSEVGGSRVRLKGERDKPWRVS
FT                   ATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLNLRANRDAVTDRWRHSDSQSLFYSLPW
FT                   GWWTFTYGYSQSDYRTRNEASGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQ
FT                   RTNNYVEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQGRGHPQA
FT                   GDPNARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGF
FT                   KDQTLTGDSGGYWRNQLRWRRAVEWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRM
FT                   SGNAIELDARGRYFAASVGFARSLERPSAIERREHPIYFRVDAFF"
FT   gene            42934..53265
FT                   /locus_tag="PA14_00510"
FT   CDS_pept        42934..53265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00510"
FT                   /product="putative hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14998"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK44"
FT                   /protein_id="ABJ14998.1"
FT                   /translation="MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQ
FT                   AGNGVPIVNIATPNGAGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKG
FT                   QAAQVILNQVTGGNRSTLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKP
FT                   IMDGQRLERFQVDGGDIVVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDV
FT                   QADSLQATPRAADGSEKPQLAIDSSALGGMYAGAIRLVGTEQGVGVKLAGDMAASGGDI
FT                   RIDASGKLSLAQASSQGDLKIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIA
FT                   LEAAHIDNAGVIEAGVEPDERRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQG
FT                   GSLKGATVRVDAGHLDNRGGKLLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDN
FT                   RGGQVIGLNDLEVGAATLDNGQQGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSL
FT                   DNRGGKLIGDDLLVVASGAIDNRLGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLG
FT                   GLLDNRDEGNLLSQGAQRVTVGQLDNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLS
FT                   ATGGAFDNRDGGSASGKAGVRVEVASLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKG
FT                   DLQATLGSLAQQGGELVSEKTLKVAADTLDNSQSGLIAANGDIAIEARQVDNRAGEISS
FT                   TSKVAVNAREQLDNRGGKVIGDSGLRLTVQRLLNQAKGVLAGRDGLSLDGGELFNGDGG
FT                   RLDSQNSLSVSLGGVLDNQGGALVSEGSLTARAARLDNRGGTFSSAGALALTSQAALDN
FT                   QGGRLLSDAGVTLKGASLDNSRSGVISAKGAVDIRTGVLDNSRNGGIGSNAGITLVAAR
FT                   LDNGQQGRVSAKGLLDANLKGLDQRGGGVLVSETGVTLDLNGGTLVNRDGGLIATPGAL
FT                   LLRQLGAVDNGVGGEISSDRAFTLAAASLDNRGGRLIGADSLTLRIAQALDNSLAGVIS
FT                   GAAGLDIAAARLDNSAKGTLASRAGIDLRVDGALDNHAEGTVSGARLTLASASLDNSGK
FT                   GLLSGNAGLSVATGALDNAEGGQLTSQGVLDVSSADLDNRGGALSGKQSLRLSAANLDN
FT                   RGGLLTSDGELELTAGRVDSADGGEISARGDLRLTVERLVQRQGRLVGERGVSLDLRGG
FT                   DLDNQGGLISARGPLSIERLNVLDNRQGGEISSQQGFELLARRIDNGQQGRIISAGKLR
FT                   LDADALGNAGAGLLSGWQGLTVTGGSLDNSAGGTLSSKDGELAISLGGALDNHGQGALV
FT                   SKGAQRIDAASLDNAQGIVSGESDVTLSIAGKLDNGQGGLVSAQRALSFERDDTLLNNA
FT                   GGRINGGSLLLKGASLDNSDGQLISQGRLDAILGGALVNTGAARLASGGDLLLRSASVD
FT                   NRGGKLVSQGLLEISAGSLDNSASGTLASQADMSLRLGGGALRNQQDGLIFSQAGALEV
FT                   QAGSLDNRQGTLQAQGDNRLRIGGALDNQGGRLDSRAGNLDLQSGSLDNGAGGVLNSAK
FT                   GWLKLVTGLFDNSAGVTQAQSLEIRAGQGVRNQQGHLSALGGDNRIVTADFDNQGGGLY
FT                   ASGLLSLDGQRFLNQGAAAGQGGKVGAGRIDFSLAGALANRFGQLESESELHLRAAAID
FT                   NSGGSLRALGRSGSTRLVAGDLNNAYGVLESANQDLDLQLGSLANAGGRILHTGNGTFG
FT                   LDSGQVIRAGGELTTNGLLDIRASEWTNSSVLQAGRLNLDIGTFRQTAEGKLLAVQSFT
FT                   GRGGDWSNDGLLASDGSLRLDLSGGYRGNGRATSLGDFALNAASLDLGNAASLAGGANV
FT                   TLGAGNLLVNRGRITAAGDLVASAASLNNYGTLGGGGNLRLNAPALLNERGLLFSGADM
FT                   TLRAGDITNLYGDVYSLGRLDIARDDAGNRAASLRNLSGVIESGKDFSLRASLIENRRA
FT                   VLESKSGLYTAKMEQTACIEGVNAGDCSGKRNAIWTITQRDKTEVTASSAMGQLLAGGD
FT                   FAIDGGTLNNLSSLIGSGGNLTANLEVLDNQGLETGELETIRVLRTARGGDIGGIDQKS
FT                   RNFTNLYWYQSANFDPARAGEIPAALNAILSDWSFEYEFPSKGPTPISSGDQSYAAVIQ
FT                   AAGDVTVNASTRIDNGVTRPGYTFVGSGRQVGDSAVGGSGVSVVVPLTSQLPPDLARRQ
FT                   VNPVTLPGFSLPHGDNGLFRLSSRFAEDGNGSAALGAGADRTQGGSGVSVGQQGAGNAA
FT                   GTWQGQGVRVDGLAGAANVQGQGGSALGGSLPGVARVQGVPGNATPSASHKYLIETNPA
FT                   LTELKQFLNSDYLLSGLGMNPDASKKRLGDGLYEQRLIRDAVVARTGQRYIDGLSSDEA
FT                   LFRYLMDNAIAYKDQLHLQLGVGLSAEQMAALTHDIVWLEEVEVNGEKVLAPVVYLAQA
FT                   EGRLAPNGALIQGRDVKLVSGGDLHNVGTLRARNDLSATADNLDNSGLIEAGKRLDLLA
FT                   GDSIRNRQGGVIAGRDVSLTALTGDVINERSVTRYDSALDGRTWERSFADSAARVEAAN
FT                   SLNVQAGRDIANLGGVLQSRGDLSLDAGRDVTVAAVEDRQGQTRWSTSRLQSVTQLGAE
FT                   VSAGRDLNVSAGRDLSAVASALEARRDIALSAGRDVTLAAAANEEHAYSKTRKVTYQED
FT                   KVAQQGTRVDAGGDLAINAGQDLRLIASQASAGDEAYLVAGDKLELLAANDSNYYLYDK
FT                   KKKGDFGRKETRRDEVTDVKAVGSQISSGGDLTLLSGGDQTYQGAKLESGNDLAIVSGG
FT                   AVTFEAVKDLHQESHEKSKGDLAWNSAKGKGQTDETLRQTQIVAQGNLAIKAADGLKID
FT                   VKHIDQKTVSETIDVMVKADPSLAWLREAEKQGDVDWRKVREVHDSFKYSHSGLGAGAA
FT                   LAIAIVVTYLTWGAGSSMAGVAAKSATGVAANSVASAVATNAAISTVNNRGNLGAVAKD
FT                   VTSSDSLKGYAVAGISGGFMPSSLGAQLAVRSALNTVVNGGKFRDNVAQAAISMAADAL
FT                   SGAIFDKVGDALVGSGLPKKVAVHAIVGGLIGEAAGGDFRTAALAAGANEALVSLVGEK
FT                   IFPGEAHERVLAMTSQLIGMTVAAAAGGDTKAQEKAAWVAQQATVYNNLNHAAAESLLK
FT                   EIKDCRAAGGCGEEKLQGILGKYEKLSAERSNAIGQCASRQCVDDIVDSSIRMDDPVSK
FT                   ELLSLLRQTTYDTPGLLQGNPDAIVSQTPNPSGWGDLFALDKQLAFAKNLKEGWLTPEE
FT                   TADLDRWNASTSWLDRTAGRQLDPKEKAYLLSELGGAAAMALLGGRGSVGSNATFGQIK
FT                   TVLDTAQAPYKGSTVIGHALSKHAGRHPEIWGKVKGSMSGWNEQAMKHFKEIVRAPGEF
FT                   RPTMNEKGITFLEKRLIDGRGVRLNLDGTFKGFID"
FT   gene            54577..54699
FT                   /locus_tag="PA14_00520"
FT   CDS_pept        54577..54699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJN0"
FT                   /protein_id="ABJ14999.1"
FT                   /translation="MVQRGHNRQVVFAEDEDYQRYLSDLRDLEDAFDNKLHAFC"
FT   gene            54909..55304
FT                   /locus_tag="PA14_00530"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0042"
FT   CDS_pept        54909..55304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIY3"
FT                   /protein_id="ABJ15000.1"
FT                   /translation="MPVLALRLTALAALAISVSGCVMEAYGSRARSDAQSWIGLPIQDV
FT                   IKRFGEPERVTGDAARQKYVWKEYENYSHDYDYTYYEQGHGNTPNSSVLNQKTGTANQS
FT                   GYYTCIYEFFADASGRVVDATARGECR"
FT   gene            complement(55575..56984)
FT                   /locus_tag="PA14_00550"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0043"
FT   CDS_pept        complement(55575..56984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00550"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15001"
FT                   /db_xref="GOA:A0A0H2ZJW4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW4"
FT                   /protein_id="ABJ15001.1"
FT                   /translation="MRLHRGGEPDGYRRQRRPHGGRRTTVQAPRGRLLLWCAQARRHPL
FT                   SRRMESSMTLSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLLGG
FT                   FATLLAGELGSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSLALT
FT                   EQRLLAAAGGIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQGYGP
FT                   WAFFNPYLTWWMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLTLARLR
FT                   ERMPDALLACALLATSALMFPRILVEIGAIHPALLKELVLPFAATTLVYLGGTLFHALR
FT                   GGRASQEAPDEPGLRNPFELLPALRFAALLSAILLLVEVGRRLFGDAGIYAVALLSGLA
FT                   DVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLIVLVGGKRLALQTLPFSLA
FT                   GLLVGALLILL"
FT   gene            57148..58476
FT                   /gene="exoT"
FT                   /locus_tag="PA14_00560"
FT   CDS_pept        57148..58476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoT"
FT                   /locus_tag="PA14_00560"
FT                   /product="exoenzyme T"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15002"
FT                   /db_xref="GOA:A0A0H2ZK02"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="InterPro:IPR014773"
FT                   /db_xref="InterPro:IPR037168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK02"
FT                   /protein_id="ABJ15002.1"
FT                   /translation="MHIQSSQQNPSFVAELSQAVAGRLGQVEARQVATPREAQQLAQRQ
FT                   EAPKGEGLLSRLGAALARPFVAIIEWLGKLLGSRAHTATQAPLSRQDAPPAASLSAAEI
FT                   KQMMLQKALPLTLGGLGKASELATLTEERLAKDHTRLASGDGALRSLATALVGIRDGSR
FT                   IEASRTQAARLLEQSVGGIALQQWGTAGGAASQHVLSASPEQLREIAVQLHAVMDKVAL
FT                   LRHAVESEVKGEPVDKALADGLVEHFGLEAEQYLGEHPDGPYSDAEVMALGLYTNGEYQ
FT                   HLNRSLRQGRELDAGQALIDRGMSAAFEKSGPAEQVVKTFRGTQGRDAFEAVKEGQVGH
FT                   DAGYLSTSRDPGVARSFAGQGTITTLFGRSGIDVSEISIEGDEQEILYDKGTDMRVLLS
FT                   AKDGQGVTRRVLEEATLGERSGHGEGLLDALDLATGTDRSGKP"
FT   gene            59018..59704
FT                   /locus_tag="PA14_00570"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0045"
FT   CDS_pept        59018..59704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00570"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15003"
FT                   /db_xref="GOA:A0A0H2ZK49"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK49"
FT                   /protein_id="ABJ15003.1"
FT                   /translation="MSHSANKALLPLLAVATLAGLAGCATETSTALPVQQVESVNRPYS
FT                   GVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSEIQ
FT                   QEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNIVNI
FT                   STSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAVDSGA
FT                   WKPQNQ"
FT   gene            59735..60088
FT                   /locus_tag="PA14_00580"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0046"
FT   CDS_pept        59735..60088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00580"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15004"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJN3"
FT                   /protein_id="ABJ15004.1"
FT                   /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGESK
FT                   EAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSIGKDDQMVREFETEKALFPESATY
FT                   MDFLLNNARGGAR"
FT   gene            60241..60750
FT                   /locus_tag="PA14_00590"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0047"
FT   CDS_pept        60241..60750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00590"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15005"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIY7"
FT                   /protein_id="ABJ15005.1"
FT                   /translation="MKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQ
FT                   VSPAKLREIYGADAALYVTVSDYGTRYMVISSATIVTASAKLVDLRSGTTLWTGSATAS
FT                   SEEGNGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRS
FT                   PRYGSD"
FT   gene            complement(60765..61148)
FT                   /locus_tag="PA14_00600"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0048"
FT   CDS_pept        complement(60765..61148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00600"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15006"
FT                   /db_xref="GOA:A0A0H2ZJX1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX1"
FT                   /protein_id="ABJ15006.1"
FT                   /translation="MSFAQNLLRLRQQNALTQRQMAERLGVTVSQLRHFETKGGHPSLV
FT                   VLQTIAGRFAVPLDWLVCERSERQALPEDLRLQFEAIGRLRLDERRAIRALLDDLIRQY
FT                   MAKRNAAAKPLPAACAEATETSP"
FT   gene            complement(61430..63091)
FT                   /locus_tag="PA14_00620"
FT   CDS_pept        complement(61430..63091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15007"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK06"
FT                   /protein_id="ABJ15007.1"
FT                   /translation="MRYARHASRYSLFTLAVSAALLPGAGWAANGDLAGARKPPSVACS
FT                   WNREAALSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFAKRLCAADG
FT                   RTPVTSYAKALKLVTEEGRALWRAAVDRAQGRRAIPAGALPASDDRMLYWTRLYMTRTL
FT                   RQWAPSFRLGKAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVFTLGT
FT                   PGTANTGLRNGNPSGATALALDGREFRLADGSLLRIEAYLLPVSYDPFNRGMQEDTLGP
FT                   WFRPGPRRVDASVTISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADSALPNYVLPLG
FT                   SVTNPGTAPISLRGSGCNINPPRRWLGYDSASRWRQNLPAQFSKASLPVRQLLAADTWR
FT                   GIERPPGATSQAAEGFDVTWHTNYDFFPDCANPRTENVPTNGVMNAMPDPSLVLPPNRR
FT                   ICARNGGGGDYLSNESAYRNTVLRDAFRLEIPAGHIHVPVMNNYYTGVPASGGGARNDN
FT                   AISDARYEAYRSAIVAQTRALLVGVGNALAQGAQAD"
FT   gene            63701..63841
FT                   /locus_tag="PA14_00630"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0050"
FT   CDS_pept        63701..63841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK54"
FT                   /protein_id="ABJ15008.1"
FT                   /translation="MKRKMLAASLLLWMFSLTAQADCAVLGPGEDPCAGPVLGPTVCEC
FT                   P"
FT   gene            64665..66497
FT                   /gene="phzH"
FT                   /locus_tag="PA14_00640"
FT   CDS_pept        64665..66497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzH"
FT                   /locus_tag="PA14_00640"
FT                   /product="potential phenazine-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15009"
FT                   /db_xref="GOA:A0A0H2ZJN6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJN6"
FT                   /protein_id="ABJ15009.1"
FT                   /translation="MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNAL
FT                   LGHRRLAVIDLSGGVQPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRSDT
FT                   EVVLHAYLQWGERCCEYLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLLFGS
FT                   EIKSILAHPEFAARLDAVGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQAKLRR
FT                   YWEVRRQEHADDLQSTVQRTRELVTRALGSQLHADVPVCSLLSGGLDSTALTGIAQRIA
FT                   KAEHGGDINSFSVDFVGQAEQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIDNAELVC
FT                   ERAREEVFRAKDVPFTFGDMDTSLHLMFGEIRRHSTVAISGEGADELFGGYGWFRDPQA
FT                   VAAARFPWASRVRLPAGFIDAGFNRRCDLLQYQQASYDDGLRQVEHLAGDSPEERRMRE
FT                   FSHLHLKRWMVLLLERKDRLSMCNGLEVRVPYTDHELVEYVYNVPWSIKSRDGEEKWLL
FT                   KRACADYVPEAVLKRRKSPYPTSANLGYERFLRGSVRRLLEDAANPVFGIVSREFLAAE
FT                   LEHPEGYFNTQVSRHNLETALALEGWLRLYGLSA"
FT   gene            complement(66550..66978)
FT                   /locus_tag="PA14_00650"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0052"
FT   CDS_pept        complement(66550..66978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15010"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIZ5"
FT                   /protein_id="ABJ15010.1"
FT                   /translation="MDLRPSHVHVFPPSRDLPAATSPHRETLLRSGCAWNGSLYLGYPL
FT                   GQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGCLM
FT                   NIIHRLIAGAEPVEALLFHAGVEGMPVGLGERGEMPDA"
FT   gene            complement(67187..67735)
FT                   /locus_tag="PA14_00660"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0054"
FT   CDS_pept        complement(67187..67735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00660"
FT                   /product="putative RNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15011"
FT                   /db_xref="GOA:Q02V26"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V26"
FT                   /protein_id="ABJ15011.1"
FT                   /translation="MDRKTLDDTSKFLSYVLRHQPEAIGLKLDGEGWADIDALIAGAAR
FT                   DGRALDRALLGAVVENNDKKRFALSADGQRIRAVQGHSHAAVAIAYAPAVPPAVLYHGT
FT                   ASRFLDSIRERGLVPGSRHHVHLSARRATALEVGRRYGSPVLLEIDARDMHLAGHLFHQ
FT                   AENGVWLTERVPVRFIREA"
FT   gene            complement(67774..68280)
FT                   /locus_tag="PA14_00670"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0055"
FT   CDS_pept        complement(67774..68280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15012"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX7"
FT                   /protein_id="ABJ15012.1"
FT                   /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDAR
FT                   LAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEGIR
FT                   EEQLDGAEERNVTLKVRGQEISFNGRDFLFGFALPNFFFHVTTAYAILRHNGVELGKMD
FT                   FLGGA"
FT   gene            complement(68346..69266)
FT                   /locus_tag="PA14_00680"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0056"
FT   CDS_pept        complement(68346..69266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00680"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15013"
FT                   /db_xref="GOA:A0A0H2ZK09"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK09"
FT                   /protein_id="ABJ15013.1"
FT                   /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWVG
FT                   ARLLHRSTRRLSLTDAGAELLPQCREMLAVADAMQATGQTRRDSPRGTLRITSSLSFAQ
FT                   AWLTRAAAAFVERYPGTAIDLQVNSQVVNLVEERIDLALRIANQLDPNLIARRLGECRS
FT                   VICAAPDYLRGHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLSANES
FT                   TVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQMPPALR
FT                   ALLDFLVERMAADPHWDEAGPLALA"
FT   gene            69374..70261
FT                   /locus_tag="PA14_00690"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0057"
FT   CDS_pept        69374..70261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00690"
FT                   /product="putative metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15014"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK59"
FT                   /protein_id="ABJ15014.1"
FT                   /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFAV
FT                   SSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKTLSTIYISHGDPDFYFGLDVLKAA
FT                   FPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHALKV
FT                   VDLKGPSPDRTVLWIPSLKTVVGGVLVESGSHVWTADTQTQASRQAWVAMLDRIEALQP
FT                   RRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLPGEEGL
FT                   ELSAKVLKGEMQWP"
FT   gene            70324..71028
FT                   /locus_tag="PA14_00700"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0058"
FT   CDS_pept        70324..71028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00700"
FT                   /product="putative protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15015"
FT                   /db_xref="GOA:A0A0H2ZJP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP1"
FT                   /protein_id="ABJ15015.1"
FT                   /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMTD
FT                   ANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEA
FT                   LDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFA
FT                   DSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLAGGSGALGG
FT                   AAAPLCRIDGCA"
FT   gene            71112..71567
FT                   /gene="osmC"
FT                   /locus_tag="PA14_00710"
FT   CDS_pept        71112..71567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PA14_00710"
FT                   /product="osmotically inducible protein OsmC"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15016"
FT                   /db_xref="GOA:A0A0H2ZJ00"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ00"
FT                   /protein_id="ABJ15016.1"
FT                   /translation="MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFN
FT                   TRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAIT
FT                   AVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
FT   gene            71678..71911
FT                   /locus_tag="PA14_00720"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0060"
FT   CDS_pept        71678..71911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15017"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY2"
FT                   /protein_id="ABJ15017.1"
FT                   /translation="MKTIGLGIATLLFSATALAAPKPCEELKAEIETKIQSAGVTSYTL
FT                   EIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
FT   gene            complement(71923..72360)
FT                   /locus_tag="PA14_00730"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0061"
FT   CDS_pept        complement(71923..72360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK13"
FT                   /protein_id="ABJ15018.1"
FT                   /translation="MRPLTRLVPLALLLLAGCAGPLPQPDPQMAWVELRSAPANTLLAE
FT                   RLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDGFE
FT                   AGRRYRLEVRPQLRRALALLSDERGEVVARSNFQTSRCPPY"
FT   gene            complement(72417..72833)
FT                   /locus_tag="PA14_00740"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0062"
FT   CDS_pept        complement(72417..72833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00740"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK65"
FT                   /protein_id="ABJ15019.1"
FT                   /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLDTQPDADLAAVEV
FT                   DDKSWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQRY
FT                   RLEAGHIGFRPWAKLYDQDNRELARGRKGRCAKV"
FT   gene            72925..74052
FT                   /locus_tag="PA14_00750"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0063"
FT   CDS_pept        72925..74052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00750"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15020"
FT                   /db_xref="GOA:A0A0H2ZJP6"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP6"
FT                   /protein_id="ABJ15020.1"
FT                   /translation="MLVGRRAVRVLCYVPPMPRRLRHPLADLRLPRWVPCLALLALSGC
FT                   STVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRERLAKAEKARQFASERLGLPDN
FT                   RSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYSEAAARAEAARQRA
FT                   LGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLATLIFHELAHQKFYLRDDTAFNES
FT                   FATFVEQEGTRQWREYRGLPPADGREEKRREQFTALVLASRARLEALYAGPLDDAAKRA
FT                   GKAAEFQRLRREYTALSQREWGGESPFKAWIDAPFNNAKLLPFGLYDQWVAAFAALFRQ
FT                   VGGNWPAFYARVRALGQLPLAERQAALQRLAAAAP"
FT   gene            complement(74060..75043)
FT                   /locus_tag="PA14_00760"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0064"
FT   CDS_pept        complement(74060..75043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15021"
FT                   /db_xref="GOA:A0A0H2ZJ05"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ05"
FT                   /protein_id="ABJ15021.1"
FT                   /translation="MTDNPFATPTAPVQPPAREVPATTQPYAFIAVLALVTCLSFAVSL
FT                   GIQWYNDIGEIRQRFSEHLQLMAPHWFTGLVFYAAANLLVLHAYREKRQLVEFRPLALL
FT                   LIGYGLLNLVCGMLAGIGLAPLTLPFYQWVTAQSSYGVWLMAFNEAMSWVYLLLGSLLP
FT                   LGLVLLGSRVNSPRLAEGEEARVAAWQVALGAALCFATLCFKLMQFLPYALLRYDEPWL
FT                   YGLYLSGVALPAALLFGAVCTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVGGGLAL
FT                   LMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLATRWCYADQLAA"
FT   gene            complement(75076..75741)
FT                   /locus_tag="PA14_00770"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0065"
FT   CDS_pept        complement(75076..75741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00770"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15022"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY8"
FT                   /protein_id="ABJ15022.1"
FT                   /translation="MRDATLRYPNILFDLDGTLTDPREGITRSVQFALARLGIDEPDLA
FT                   RLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRVTGLYENRVFDGIPELLEALVG
FT                   RGHTLYVATSKPGVFAREIARHFAFDRHFKAIYGSELDGTRTHKDELIRHLLDSEGLAA
FT                   EHCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVLESH"
FT   gene            complement(75734..76276)
FT                   /locus_tag="PA14_00780"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0066"
FT   CDS_pept        complement(75734..76276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00780"
FT                   /product="putative carbonic anhydrases"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15023"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK15"
FT                   /protein_id="ABJ15023.1"
FT                   /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGADSSVWPLVVIRG
FT                   DMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNRVLV
FT                   GMGSIVMDGAVIEDQVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFTYTA
FT                   GNYVKLKDLHIAEDYHA"
FT   gene            76354..78399
FT                   /gene="prlC"
FT                   /locus_tag="PA14_00790"
FT   CDS_pept        76354..78399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PA14_00790"
FT                   /product="oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15024"
FT                   /db_xref="GOA:A0A0H2ZK71"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK71"
FT                   /protein_id="ABJ15024.1"
FT                   /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLETQ
FT                   REQPTWKGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTELGQ
FT                   NRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSRLSE
FT                   LGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEFPSYY
FT                   AVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLGFANYA
FT                   ELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCTELQSWDAGYYAE
FT                   KLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADVRLFEILE
FT                   NGEHVGRFYFDLYARANKRGGAWMDGARDRRRDAQGRLIDPVAYLVCNFTPAVNGKPAL
FT                   LTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENWCWEPEGLAL
FT                   ISAQYETGEALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHGDGRSVLQVLE
FT                   GIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGVFNPD
FT                   TGRAFREAILARGGSREPMLLFVDFRGREPSIDALLRHSGLVGEAA"
FT   gene            78396..78671
FT                   /locus_tag="PA14_00800"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0068"
FT   CDS_pept        78396..78671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00800"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15025"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ0"
FT                   /protein_id="ABJ15025.1"
FT                   /translation="MSPAITRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYAD
FT                   TLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
FT   gene            78760..79818
FT                   /locus_tag="PA14_00810"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0069"
FT   CDS_pept        78760..79818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00810"
FT                   /product="putative DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15026"
FT                   /db_xref="GOA:A0A0H2ZJ11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ11"
FT                   /protein_id="ABJ15026.1"
FT                   /translation="MSAPLPPRGRGTASNPLNRFAPTHSEAFDDGWEQDVPPIQLTEVR
FT                   EEIARTVISRNQSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGIDFETRLIAK
FT                   SNVASALEQELSKPGYRCAPINLGANTDPYQPLERERRLTRQVLEVLLRFRHPLTIVTK
FT                   GSLILRDLDLLRELAEQNLVAVMISLTTLDDELKRILEPRAAAPSARLRAIRTLSGNGI
FT                   PVGVLCSPMIPMVNDMELERLLQAARDAGARSAAYMLLRLPREVGPLFEEWLAAHYPQR
FT                   AEHVMSLVRQCRGGEVYDSRFGHRFRGQGPFADLLAQRFAVAMKRLGLDRREGFGLDCS
FT                   RFAVPGAQMALF"
FT   gene            complement(80049..80963)
FT                   /locus_tag="PA14_00820"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0070"
FT   CDS_pept        complement(80049..80963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15027"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ5"
FT                   /protein_id="ABJ15027.1"
FT                   /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAE
FT                   YYPSCYEPVSHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGAL
FT                   AGGAAGYYMEKQKQISDDRARIGSYATDVDRSTVEINRSVAYAKSAQSCYQSQFKALLD
FT                   GRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENINNYTQAYEKDLQQVGVPR
FT                   TEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASRGQ
FT                   GMIQEVCNSPDMGDWAPPSCAKA"
FT   gene            complement(81025..82737)
FT                   /locus_tag="PA14_00830"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0071"
FT   CDS_pept        complement(81025..82737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15028"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK19"
FT                   /protein_id="ABJ15028.1"
FT                   /translation="MFEKAILPLALGACLAFAAPAWAEGDSPDNPKPLADDVALPLPCG
FT                   GEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPA
FT                   WQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDVPGG
FT                   MAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGGIGFVRLPTEVEW
FT                   EFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLPVGMKR
FT                   PNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYP
FT                   LFAADGSEQRNETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQ
FT                   LDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIR
FT                   LTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTRYTDAVIQAQ
FT                   FQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLASSGR"
FT   gene            complement(82730..83929)
FT                   /locus_tag="PA14_00850"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0072"
FT   CDS_pept        complement(82730..83929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00850"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15029"
FT                   /db_xref="GOA:A0A0H2ZK77"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK77"
FT                   /protein_id="ABJ15029.1"
FT                   /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYGL
FT                   VSTLTERLERAPSVREIIPVGGARYRAEDIAALAARADVAFAVPRTRQIAATADLSGGG
FT                   ETALSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRMDGQ
FT                   AQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVAAYGWPGKAGETPRAR
FT                   IYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVAALAIG
FT                   GAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMFLALFSAVFGLFLAGLLYAA
FT                   TAGALNHLFDNQSGEFVCRLLPSHYLTALLATLLCSVLAAASGGWRAARIEAAEGLRDV
FT                   "
FT   gene            complement(83929..84648)
FT                   /locus_tag="PA14_00860"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0073"
FT   CDS_pept        complement(83929..84648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00860"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15030"
FT                   /db_xref="GOA:A0A0H2ZJQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ6"
FT                   /protein_id="ABJ15030.1"
FT                   /translation="MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGKS
FT                   TLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLAALRRQHCGYVLQSGGLL
FT                   EFLDVRRNIGLPCALLGAPSAERVQALAERLEIGDQLDKKPAALSVGQRQRVAIARALA
FT                   HAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEVLAIR
FT                   WQREADDSVGACLEDVG"
FT   gene            complement(84645..87743)
FT                   /gene="ppkA"
FT                   /locus_tag="PA14_00875"
FT   CDS_pept        complement(84645..87743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppkA"
FT                   /locus_tag="PA14_00875"
FT                   /product="serine/threonine protein kinase PpkA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15671"
FT                   /db_xref="GOA:A0A0H2ZKT3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT3"
FT                   /protein_id="ABJ15671.1"
FT                   /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAA
FT                   DPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPE
FT                   QGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQV
FT                   GFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEP
FT                   LPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGS
FT                   PRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPP
FT                   LPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSDDAPSPVDPAPLGQTPTDKPQQ
FT                   QTPVADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYA
FT                   RKQVGGSPWLRVGASSNGEGDGWLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVE
FT                   RLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPA
FT                   QLLEVASIDPGGSATAPQAPGQAGRGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVRE
FT                   VIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSS
FT                   QVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNE
FT                   AEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVN
FT                   AFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIGYAMQMEFLGRRDPVR
FT                   APQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLIVDAAKRTQTSPKDFFQ
FT                   EIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWLSLSVAEQQD
FT                   FIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP"
FT   gene            complement(87751..88479)
FT                   /locus_tag="PA14_00890"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0075"
FT   CDS_pept        complement(87751..88479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00890"
FT                   /product="putative serine/threonine phosphoprotein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15031"
FT                   /db_xref="GOA:A0A0H2ZJ15"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ15"
FT                   /protein_id="ABJ15031.1"
FT                   /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMGG
FT                   HAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLV
FT                   LLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNALISEEEARHHPRANV
FT                   VTRAVGVHEQLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLSHSDPYAVVRSLV
FT                   HLGLTRGAPDNITALVVRAF"
FT   gene            complement(88489..89169)
FT                   /locus_tag="PA14_00900"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0076"
FT   CDS_pept        complement(88489..89169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15032"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK01"
FT                   /protein_id="ABJ15032.1"
FT                   /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELG
FT                   AAWLDAYLTSPLWRFAIAPGLLGGEAVAGVVMPSIDRVGRYFPLTVACLLPANADLGGL
FT                   VGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAV
FT                   TPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFP
FT                   GIPG"
FT   gene            complement(89166..92474)
FT                   /locus_tag="PA14_00910"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0077"
FT   CDS_pept        complement(89166..92474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15033"
FT                   /db_xref="GOA:A0A0H2ZK24"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK24"
FT                   /protein_id="ABJ15033.1"
FT                   /translation="MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSER
FT                   RNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAV
FT                   LLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERA
FT                   AHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALD
FT                   DGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGE
FT                   FLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRS
FT                   YFIERLFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQS
FT                   YIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLG
FT                   EESASVYRKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKA
FT                   WISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQR
FT                   VYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTA
FT                   SLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNV
FT                   TQAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSL
FT                   VGQEEEEGAREQPQQADSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVS
FT                   AMAGASGDSLLGDAKNQVAAAASRVALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQL
FT                   NAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAGGVMDSYFRQYLQPYVDT
FT                   SASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPAVRFELKPVTMDAAIS
FT                   QFILDLDGQQLTYDHGPARPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFR
FT                   LLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL"
FT   gene            complement(92696..94045)
FT                   /locus_tag="PA14_00925"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0078"
FT   CDS_pept        complement(92696..94045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15641"
FT                   /db_xref="GOA:A0A0H2ZKR2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR2"
FT                   /protein_id="ABJ15641.1"
FT                   /translation="MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGD
FT                   PYTPPPMASLAPLSGRGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQ
FT                   FEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEK
FT                   VFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTR
FT                   GEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKR
FT                   IHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELF
FT                   ASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEV
FT                   ADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
FT   gene            complement(94052..95386)
FT                   /locus_tag="PA14_00940"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0079"
FT   CDS_pept        complement(94052..95386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15034"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK83"
FT                   /protein_id="ABJ15034.1"
FT                   /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGF
FT                   SELKLDDALLTQGKLAIVSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPL
FT                   KRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGLGEY
FT                   AAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALAGRVV
FT                   ASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQR
FT                   RPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLI
FT                   DNASFVLVVRADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPY
FT                   HAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
FT   gene            complement(95402..95866)
FT                   /locus_tag="PA14_00960"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0080"
FT   CDS_pept        complement(95402..95866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00960"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15035"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR0"
FT                   /protein_id="ABJ15035.1"
FT                   /translation="MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQ
FT                   AAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDE
FT                   QTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP"
FT   gene            complement(95911..96453)
FT                   /locus_tag="PA14_00970"
FT   CDS_pept        complement(95911..96453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15036"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ19"
FT                   /protein_id="ABJ15036.1"
FT                   /translation="MKVDPAGAEAQMEAIRRTYRCLVEGLVDVLRTLDNLKGEFRMAQT
FT                   MIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAA
FT                   IRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
FT                   REFSRAYEEHSARLRRS"
FT   gene            complement(96450..97409)
FT                   /locus_tag="PA14_00980"
FT   CDS_pept        complement(96450..97409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15037"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK07"
FT                   /protein_id="ABJ15037.1"
FT                   /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPER
FT                   LVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQ
FT                   LGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDT
FT                   KPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPLPPATTPAPPPAGGAPLIPADW
FT                   DPFAELLGNTPAPSATPVVQPQPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQP
FT                   QPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQ"
FT   gene            97777..98811
FT                   /locus_tag="PA14_00990"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0082"
FT   CDS_pept        97777..98811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15038"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK28"
FT                   /protein_id="ABJ15038.1"
FT                   /translation="MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDA
FT                   VLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLGQY
FT                   WDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAG
FT                   LQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGVAERVGSAQGLDL
FT                   GPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAATGEQGGAAPVAAVAAPAPRASGEIAN
FT                   REDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRG
FT                   PESE"
FT   gene            98900..99418
FT                   /locus_tag="PA14_01010"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0083"
FT   CDS_pept        98900..99418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15039"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK88"
FT                   /protein_id="ABJ15039.1"
FT                   /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMAD
FT                   LAGKPAEPQAAVADRKFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESM
FT                   DDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALASAP
FT                   KPKDDEPQA"
FT   gene            99431..100927
FT                   /locus_tag="PA14_01020"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0084"
FT   CDS_pept        99431..100927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15040"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR5"
FT                   /protein_id="ABJ15040.1"
FT                   /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAV
FT                   RTLAEHALEQTSLISNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYL
FT                   VNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCL
FT                   VGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTT
FT                   PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWAN
FT                   SAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCR
FT                   FAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVE
FT                   EVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
FT   gene            101003..101491
FT                   /locus_tag="PA14_01030"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0085"
FT   CDS_pept        101003..101491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15041"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="PDB:4KSR"
FT                   /db_xref="PDB:4KSS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ24"
FT                   /protein_id="ABJ15041.1"
FT                   /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGG
FT                   GGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKE
FT                   VLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA"
FT   gene            101659..102504
FT                   /locus_tag="PA14_01040"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0086"
FT   CDS_pept        101659..102504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01040"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15042"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK14"
FT                   /protein_id="ABJ15042.1"
FT                   /translation="MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRS
FT                   QPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVF
FT                   AGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAW
FT                   LADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVA
FT                   LLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
FT                   "
FT   gene            102506..103015
FT                   /locus_tag="PA14_01060"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0087"
FT   CDS_pept        102506..103015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15043"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK32"
FT                   /protein_id="ABJ15043.1"
FT                   /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVL
FT                   RDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATF
FT                   EPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQ
FT                   GERRRT"
FT   gene            103012..104871
FT                   /locus_tag="PA14_01070"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0088"
FT   CDS_pept        103012..104871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15044"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK96"
FT                   /protein_id="ABJ15044.1"
FT                   /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPY
FT                   VERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGAL
FT                   SSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPAAVLGRLAASE
FT                   PRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN
FT                   AWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRALR
FT                   RCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVI
FT                   VDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSK
FT                   QRRKGPRSTYVGSETFVALVDANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFT
FT                   LEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGAAALRELLRL
FT                   YGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTGVFLL
FT                   GAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
FT   gene            104835..105881
FT                   /locus_tag="PA14_01080"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0089"
FT   CDS_pept        104835..105881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15045"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS0"
FT                   /protein_id="ABJ15045.1"
FT                   /translation="MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLG
FT                   HSVRLADDPLRLGQKPDCTFAPSTLASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTE
FT                   YARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAALSG
FT                   RGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQWLELP
FT                   ERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWVA
FT                   EYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPH
FT                   EHKEKEHE"
FT   gene            105874..108582
FT                   /gene="clpB"
FT                   /locus_tag="PA14_01100"
FT   CDS_pept        105874..108582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="PA14_01100"
FT                   /product="putative ClpA/B-type chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15046"
FT                   /db_xref="GOA:A0A0H2ZJ28"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ28"
FT                   /protein_id="ABJ15046.1"
FT                   /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQI
FT                   LQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGS
FT                   LMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPENGLS
FT                   ASDGFNAGAAPGEASGALAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLV
FT                   DILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGAS
FT                   MKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLR
FT                   TVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEKHHQVQILDE
FT                   ALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELA
FT                   IIRRESAIGVATAERQRNAETLLAEERERLAALEQRWAEEKRLVDELLETRARLRAAAE
FT                   AVDAGGAPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEPLILPTVDYQAVASVVA
FT                   DWTGIPVGRMARNEIDTVLNLDRHLKKRIIGQDHALEMIAKRIQTSRAGLDNPSKPIGV
FT                   FMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEG
FT                   GVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTT
FT                   NAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAI
FT                   SRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMIDAILTNTLLPDMSRE
FT                   FLTRMLEGKPLAGVRISSRDNQFHYDFAEAE"
FT   gene            108629..110560
FT                   /locus_tag="PA14_01110"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0091"
FT   CDS_pept        108629..110560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15047"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK21"
FT                   /protein_id="ABJ15047.1"
FT                   /translation="MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPN
FT                   LPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTS
FT                   DCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEG
FT                   IYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPG
FT                   SLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQA
FT                   QHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQF
FT                   ESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQ
FT                   SNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPY
FT                   ELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVG
FT                   HDRNKSIGHDELVRIGNNRTRAVKLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSV
FT                   VEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQA
FT                   MFPPPAKG"
FT   gene            complement(110675..110959)
FT                   /locus_tag="PA14_01120"
FT   CDS_pept        complement(110675..110959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15048"
FT                   /db_xref="InterPro:IPR040818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK35"
FT                   /protein_id="ABJ15048.1"
FT                   /translation="MSPVNYVERALALVAERLARHPQCGMLLSVEKQLLYLKAVLLDRS
FT                   LDRSALHRLSFGGIAGKEFEETDPELARALKDAFYVGIRTGRGLKVDLP"
FT   gene            complement(110972..111205)
FT                   /locus_tag="PA14_01130"
FT   CDS_pept        complement(110972..111205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA1"
FT                   /protein_id="ABJ15049.1"
FT                   /translation="MAIEKGEAFARRDIYIDYDFEDVTYRWDHRQGTIHVRFYGEAESP
FT                   EPVEHDNRLFNDALRFGREITREEYETGFPKG"
FT   gene            complement(111195..112514)
FT                   /locus_tag="PA14_01140"
FT   CDS_pept        complement(111195..112514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15050"
FT                   /db_xref="GOA:A0A0H2ZJS4"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS4"
FT                   /protein_id="ABJ15050.1"
FT                   /translation="MVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIV
FT                   KGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIA
FT                   EGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEAL
FT                   GLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMA
FT                   LLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAAKAEIDAVADGLAAKHGGRVAKA
FT                   PIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANRGAKVKVIDGNA
FT                   DPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPG
FT                   GQGHKYYEDWRVLDPKSPEAQAIAEKSRAYYDAVRKGNGN"
FT   gene            complement(112593..113027)
FT                   /locus_tag="PA14_01150"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0094"
FT   CDS_pept        complement(112593..113027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15051"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ35"
FT                   /protein_id="ABJ15051.1"
FT                   /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDAS
FT                   QGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVF
FT                   IERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPRPTPS"
FT   gene            113281..115506
FT                   /locus_tag="PA14_01160"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0095"
FT   CDS_pept        113281..115506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15052"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK27"
FT                   /protein_id="ABJ15052.1"
FT                   /translation="MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISE
FT                   NPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLT
FT                   RTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLME
FT                   QEGIYYWFRHERNRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREV
FT                   QSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEA
FT                   LQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGADYRVVQELYETGGGGVG
FT                   AQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWIRVSQAWAGKNWGSVQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDESH
FT                   WVGHDRTKTIDYDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVG
FT                   SNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADR
FT                   SESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLV
FT                   TGAASIRMKKDGSIVISGKNITIDGSGAINIKADKNVVVKGRKILQN"
FT   gene            115534..115983
FT                   /locus_tag="PA14_01170"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0096"
FT   CDS_pept        115534..115983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK40"
FT                   /protein_id="ABJ15053.1"
FT                   /translation="MSVEIHLPGATTALPARLDGVVIGVLLDVPDAAAPVVAYPGCPSE
FT                   HGLAAATTTQLSRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEALAQLDGERLEFSAE
FT                   REIVLRCGKASITLTRAGKVIIHGAYLSSRSTGVNRIKGGSVQIN"
FT   gene            115913..117112
FT                   /locus_tag="PA14_01180"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0097"
FT   CDS_pept        115913..117112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15054"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA6"
FT                   /protein_id="ABJ15054.1"
FT                   /translation="MAPTSPAAPPGSTGSRAVRCRSTERGGPDMELLNATPLAAAYNQG
FT                   LDAEGRESLVVIAKGSFDLPLDGREARLLDEQQALLMVDEFYGEPGLSAPRRECEFVPF
FT                   KPFCDVLVLGSAQAPGGRPVQQLTAGIRVGRVSKALAVHGPRQWEPGLLGAGAGVAQPF
FT                   QRQDISYASAFGGSHASPDNPDFMDCYMANPAGCGWFPRSADTAEIVGTPMPATEKLGE
FT                   PVDSPHGRFTPMALGPLGRHWQARVGFAGRYDDAWLAERFPFLPADFDERYFQSAPADQ
FT                   WTDHLRGGEEVLLLNLTGEERAAFRVPRREVPVTFFLKKGGHETAQARIDTLLVDCDAR
FT                   RVEVTWRIRRPLKRNLFEIAQVLVGSKSAAWWRARELGKDYYPSLAALARSRQAEEDEA
FT                   "
FT   gene            117109..118146
FT                   /locus_tag="PA14_01190"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0098"
FT   CDS_pept        117109..118146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01190"
FT                   /product="Putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15055"
FT                   /db_xref="GOA:A0A0H2ZJS8"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS8"
FT                   /protein_id="ABJ15055.1"
FT                   /translation="MSQALSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGGE
FT                   WLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPDLDCTELPLLLCVAEGDRPGRCAG
FT                   LDESFLRDLEGELGRRFHPSSALIARGRVGGAVALLNARKLIQGGCRQVLVAGVDSFVS
FT                   GPTLAAYEARERLLTSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGIEKATVE
FT                   SEDLPLRADGLTQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNLRVLKP
FT                   KFDLWHPADCIGECGAAIGPALLAVALAASCKGYGDGPNVFCHLGNDAGERAAALLSYR
FT                   RVRAA"
FT   gene            118146..119237
FT                   /locus_tag="PA14_01200"
FT   CDS_pept        118146..119237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15056"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR028917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ41"
FT                   /protein_id="ABJ15056.1"
FT                   /translation="MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIP
FT                   YPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYF
FT                   TSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPPWIYSDKQTMALHKDCEEDVQKEKTA
FT                   CAGKKTKAEKCADDGCKKARKCLLVSYNQGKRKSGIGCCPGEQPHHLIEAHCFYEVGKR
FT                   GEGDSMFFNAPAGKQPYKDTESPCVCAEGPRHAGEHGQYHAFQQALEAKHHEKSGGWTY
FT                   ADARNAGVKANKAVNEQCNDKCTAAQLDSYHKERCGVTDSTPLRTDPQAGTRSVGTLDA
FT                   KQTAALQAEIGAMSGMSAAGGSL"
FT   gene            119248..120168
FT                   /locus_tag="PA14_01220"
FT   CDS_pept        119248..120168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK33"
FT                   /protein_id="ABJ15057.1"
FT                   /translation="MSFEKNHFSYLHGVVQSRTTIRAVAQIDQLTEQGAANATLIKWNL
FT                   SSPPPAAFNLAWYCTRMAIQKVPRGGGIELIYMGPDGHMGYGTANGDSEAPIWPAGEGP
FT                   DVYGVLRDLQGIGDGVYAVGMGRQVYRRDPSGAWQRKDAGTLQDRELMDVVGFNAIHGL
FT                   DEADLYAVGYAGEVWRCGNGRWEHLDSPTNVILNAVHMLPDRRVVVAGKNGFLMIGSAS
FT                   AWKVVETGLDAQIWDVQYFNDDIYLATSNALYRLDAHHVPQQVDMRLCGPVTCGQLHAG
FT                   DGILLSTGRKHQCWSDDGSVWHDLT"
FT   gene            120178..121410
FT                   /locus_tag="PA14_01230"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0101"
FT   CDS_pept        120178..121410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15058"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK43"
FT                   /protein_id="ABJ15058.1"
FT                   /translation="MLTSVVLDQHAEEAAFLALLRDYAVRAPHYDLEELAELDQRIEAH
FT                   LDGLAIAGQAGHDALLEQLDAHAQGEAFALAVLAMQAGDDALIGRMRACLAASPEARRG
FT                   FAAALGWLDWGQARPWVERLLASPEPLFRAIGLAACGMHRHDPGPALLSALGHADPAVL
FT                   ARAARTAGELRRRDLMANIRAYRAHDDPSLRFWANWATAQMGDEEALGPLRAFAGQPGP
FT                   FQLPATMVLLAWQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQMRDES
FT                   LARVAGEAFSLITGADLALLDLELEALPDYDPGPNDDPDDDNVALDDDENLTWPEAERV
FT                   SAWWRDNGARFVAGRAYLLGEPLGEARCRQVLRNGQQRQRMAAACLLARFVPNLPLFPT
FT                   GAPVRRQLDLF"
FT   gene            121786..122514
FT                   /locus_tag="PA14_01240"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   PA0102"
FT   CDS_pept        121786..122514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01240"
FT                   /product="probable carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15059"
FT                   /db_xref="GOA:A0A0H2ZKB2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB2"
FT                   /protein_id="ABJ15059.1"
FT                   /translation="MPDRMRGVKSDSPEQESADDALKRIVDGFQHFRREVFPEQQALFK
FT                   KLANSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEY
FT                   AVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDCGAS
FT                   HDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQGRFL
FT                   PLDGEHPVPMATPAPRYLNS"
FT   gene            122725..124296
FT                   /gene="ychM"
FT                   /locus_tag="PA14_01250"
FT   CDS_pept        122725..124296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychM"
FT                   /locus_tag="PA14_01250"
FT                   /product="putative sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15060"
FT                   /db_xref="GOA:A0A0H2ZJT1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT1"
FT                   /protein_id="ABJ15060.1"
FT                   /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMPPAK
FT                   GLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQLLA
FT                   GRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAAFAA
FT                   LGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLALDVR
FT                   RVEVPANLGEAIDWLRPVDLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLHDGPRS
FT                   DMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLLAFVLLL
FT                   GSLLRQIPVASLAGVLVYTGVKLVDFKALGNLSRYGRMPMLVYAATALAIVFTDLLTGV
FT                   LVGFALTLLKLVLKAARLKIALRYTGEHEAELRLSGAATFLKVPALSRVLDEVKPGTTL
FT                   HVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRGSVGLGGARNG
FT                   GAVSPG"
FT   gene            124433..125029
FT                   /locus_tag="PA14_01270"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0104"
FT   CDS_pept        124433..125029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ46"
FT                   /protein_id="ABJ15061.1"
FT                   /translation="MVDGFVQPVGEGLADQLVGHQVGHGGVQWDQRLAEVGDVAVVHFF
FT                   HQAVRQVGLIEQGVEAVVAGEQRRRGEEELLGDLQHRLDPFLDAGFAGHAVGGVEQVRY
FT                   LFDVGVDEAGEYVFRVLALRLDGAMQAGQAAGYQISQVTVAGFAEVRLLDEFTEGSGVH
FT                   GFSHTTGMVKKRRNIAGGARRLRRDCHNRFVVMRG"
FT   gene            125293..126417
FT                   /gene="coxB"
FT                   /gene_synonym="coxII"
FT                   /gene_synonym="ctaC"
FT                   /locus_tag="PA14_01290"
FT   CDS_pept        125293..126417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /gene_synonym="coxII"
FT                   /gene_synonym="ctaC"
FT                   /locus_tag="PA14_01290"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15062"
FT                   /db_xref="GOA:A0A0H2ZK39"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK39"
FT                   /protein_id="ABJ15062.1"
FT                   /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMT
FT                   IFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPA
FT                   TRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQDQIHNRQAKDEHYL
FT                   LEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRG
FT                   QCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKV
FT                   YHTICAACHQAEGQGMPPMFPALKGSKIVTGPKEHHLEVVFNGVPGTAMAAFGKQLNEV
FT                   DLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
FT   gene            126427..128019
FT                   /gene="coxA"
FT                   /gene_synonym="ctaD"
FT                   /locus_tag="PA14_01300"
FT   CDS_pept        126427..128019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /gene_synonym="ctaD"
FT                   /locus_tag="PA14_01300"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15063"
FT                   /db_xref="GOA:A0A0H2ZK46"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK46"
FT                   /protein_id="ABJ15063.1"
FT                   /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSFM
FT                   MFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPL
FT                   MIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHSVTF
FT                   FIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFAR
FT                   KPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTGVKVFNW
FT                   VTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRGGKPAPAKPWDGAEGLEWSIPSP
FT                   APYHTFSTPPEVK"
FT   gene            128030..128584
FT                   /gene="coxG"
FT                   /locus_tag="PA14_01310"
FT   CDS_pept        128030..128584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="PA14_01310"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15064"
FT                   /db_xref="GOA:A0A0H2ZKB7"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB7"
FT                   /protein_id="ABJ15064.1"
FT                   /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPLYDVMCRALGINGK
FT                   TAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARNPS
FT                   DKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDVRHV
FT                   TLAYTLFDITARKPPVPVAGR"
FT   gene            128595..129482
FT                   /gene="coIII"
FT                   /gene_synonym="cox3"
FT                   /gene_synonym="coxC"
FT                   /locus_tag="PA14_01320"
FT   CDS_pept        128595..129482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coIII"
FT                   /gene_synonym="cox3"
FT                   /gene_synonym="coxC"
FT                   /locus_tag="PA14_01320"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15065"
FT                   /db_xref="GOA:A0A0H2ZJT6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT6"
FT                   /protein_id="ABJ15065.1"
FT                   /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHKESH
FT                   GPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAAFF
FT                   GALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWKLPL
FT                   INTILLVTSSFTVTFAHHALKKNKRGPLKAWLALTVLLGIAFLILQAEEYVHAYNELGL
FT                   TLGAGIYGSTFFMLTGFHGAHVTLGALILSIMLIRILRGHFDAEHHFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVI"
FT   gene            complement(129498..129707)
FT                   /locus_tag="PA14_01330"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0109"
FT   CDS_pept        complement(129498..129707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15066"
FT                   /db_xref="GOA:A0A0H2ZJ51"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ51"
FT                   /protein_id="ABJ15066.1"
FT                   /translation="MLKVAIVLLLLATLVSLFSGLFFLVKDQGHGSRVVNSLTVRVVLA
FT                   AATLALVAWGFYSGELNSHAPWHF"
FT   gene            129723..130517
FT                   /locus_tag="PA14_01340"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0110"
FT   CDS_pept        129723..130517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15067"
FT                   /db_xref="GOA:A0A0H2ZK45"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK45"
FT                   /protein_id="ABJ15067.1"
FT                   /translation="MGGFMQYSQRLGEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLW
FT                   LGTWQLQRADEKRALLASYEARRGAEPVSPGQLEGLRDPAYVRVRLHGRFDERHTLLLD
FT                   NRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVAWTDRRSPPTLETPDRVLLLDAWTYLP
FT                   PPGGLHLADAPAGGWPRLVTQLDIPALWQAFGRAGLPWEIRLEPGDASFDTDWPLVSMP
FT                   PERHTGYAVQWFALATALLALYLYLGVRRAREKNHESRDSDA"
FT   gene            130492..131070
FT                   /locus_tag="PA14_01350"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0111"
FT   CDS_pept        130492..131070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15068"
FT                   /db_xref="GOA:A0A0H2ZK48"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK48"
FT                   /protein_id="ABJ15068.1"
FT                   /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVP
FT                   QGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQVNIALG
FT                   REASRAGHALAASGELPADFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHG
FT                   NLVLRYDAKANGKKLLKDVQLLLKLSHIG"
FT   gene            131135..132208
FT                   /gene="ctaA"
FT                   /locus_tag="PA14_01360"
FT   CDS_pept        131135..132208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="PA14_01360"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15069"
FT                   /db_xref="GOA:A0A0H2ZKC3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC3"
FT                   /protein_id="ABJ15069.1"
FT                   /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPGC
FT                   YGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVRRG
FT                   RDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALRLSG
FT                   RFAARRYPAATRGLAGLALFLVIGQIALGGWVSSNYAAVACIDLPTCHGEWWPRMDFAN
FT                   GFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVWPTALM
FT                   LLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRAPAPSPQ
FT                   RVRRTLPPAQGSRLKAA"
FT   gene            132234..133148
FT                   /gene="ctaB"
FT                   /locus_tag="PA14_01380"
FT   CDS_pept        132234..133148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="PA14_01380"
FT                   /product="putative cytochrome c oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15070"
FT                   /db_xref="GOA:Q02UW5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UW5"
FT                   /protein_id="ABJ15070.1"
FT                   /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPLD
FT                   GFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALGFA
FT                   LLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAPPLL
FT                   GWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERYTKLH
FT                   ILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIKTFKYS
FT                   IVYLFLLFMALLVDHYLPLKLLL"
FT   gene            133174..133809
FT                   /locus_tag="PA14_01390"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0114"
FT   CDS_pept        133174..133809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01390"
FT                   /product="putative Sco1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15071"
FT                   /db_xref="GOA:A0A0H2ZJU0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU0"
FT                   /protein_id="ABJ15071.1"
FT                   /translation="MTRVNKTVLVLVALVALVLGLTVHKVLTAQRQADPTVLLDAGIVI
FT                   LPQTRKVPALEFTNQDGQAVSTASLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKLPQ
FT                   EVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANAMSIPYIPAD
FT                   TSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
FT   gene            complement(133849..134301)
FT                   /gene="elaA"
FT                   /locus_tag="PA14_01400"
FT   CDS_pept        complement(133849..134301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elaA"
FT                   /locus_tag="PA14_01400"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15072"
FT                   /db_xref="GOA:A0A0H2ZJ57"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ57"
FT                   /protein_id="ABJ15072.1"
FT                   /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDL
FT                   VGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAA
FT                   ERLWLDTPVYLSAQAHLQAYYGRYGFVAVTEVYLEDDIPHIGMRRA"
FT   gene            134433..134906
FT                   /locus_tag="PA14_01410"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0116"
FT   CDS_pept        134433..134906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01410"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15073"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK50"
FT                   /protein_id="ABJ15073.1"
FT                   /translation="MRWEELSEQPCSLARVLAILGDRWTLLVLRDCFLGVRRFDDFERS
FT                   LGVTRHVLADRLKRLVEAEILAKVPYQERPLREEYRLTEKGMELYPAILSLVNWGDRHL
FT                   AGVEGPPLEHVHKHCGQHMHGVLVCSECGEPLHARDVTVREGLFWKGRLLRRG"
FT   gene            135162..135890
FT                   /locus_tag="PA14_01430"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0117"
FT   CDS_pept        135162..135890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01430"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15074"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK51"
FT                   /protein_id="ABJ15074.1"
FT                   /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPLV
FT                   QAIRDQGGEALACGCDARQEQQVIDLFARIEGEVGALEAVIFNVGANVWFPITETTERV
FT                   YRKVWEMAAFGGFLTGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFALRAL
FT                   AQSMARELGPKGIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETYWQIH
FT                   CQPRDCWVHELDLRPWMETF"
FT   gene            135915..136502
FT                   /locus_tag="PA14_01440"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0118"
FT   CDS_pept        135915..136502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01440"
FT                   /product="putative 2-hydroxychromene-2-carboxylate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15075"
FT                   /db_xref="GOA:A0A0H2ZKC7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC7"
FT                   /protein_id="ABJ15075.1"
FT                   /translation="MSKQIEFFFDFGSPTTYLAWTQLPRIAAAHGASIAWRPMLLGGVF
FT                   KATGNHSPIEVPAKGRYTLHDLARYAKRYGVPLAFNPAFPINTLTLMRGAQGYLGGEGF
FT                   HPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTEEAV
FT                   RRGVFGAPSFFVGDQLFFGQDRLDFVAEALAG"
FT   gene            136732..138081
FT                   /gene="dctA"
FT                   /locus_tag="PA14_01460"
FT   CDS_pept        136732..138081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /locus_tag="PA14_01460"
FT                   /product="putative dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15076"
FT                   /db_xref="GOA:Q02UV9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UV9"
FT                   /protein_id="ABJ15076.1"
FT                   /translation="METPAMFIKRCSRSIFLQVVIGLVIGVICGVGIPDLAVQMKPLGD
FT                   GFIKLIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYS
FT                   LGLGSGANIHLNELPAGDVALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQVLLF
FT                   SVLFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDS
FT                   LSHLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELMIVMGTASSDAVLP
FT                   QVMRKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMTDLVTIL
FT                   LVSLVTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIGNC
FT                   VATVTIARWENDIDMPRAQAILDGRLEAPAKADGEPLKRSAVAGEGKLHG"
FT   gene            138130..138816
FT                   /locus_tag="PA14_01470"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0120"
FT   CDS_pept        138130..138816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01470"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15077"
FT                   /db_xref="GOA:A0A0H2ZJU3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU3"
FT                   /protein_id="ABJ15077.1"
FT                   /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISRP
FT                   SLREAIMVLETLGVVRSLPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFIVG
FT                   IVAQSAGAAEISELRLLLLDLREAVEDGDPQALVEAYTAFHRRLVKLTSNPIFLSVSEQ
FT                   IGSALERSDNLVRRQPEYAEEILQEHDAILRAIRQHDSERASQAMRQHILNEGARLNID
FT                   LRLPQV"
FT   gene            138917..139651
FT                   /locus_tag="PA14_01480"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0121"
FT   CDS_pept        138917..139651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01480"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15078"
FT                   /db_xref="GOA:A0A0H2ZJ64"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ64"
FT                   /protein_id="ABJ15078.1"
FT                   /translation="MVGFDARTQQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKETL
FT                   GQIFRVSNGTIQRALTRLAEDGAVVMPPKEVASVARPDERQARQVLDARLLVESEVVRQ
FT                   LPAGLDPAALAELRALVDEEQACLAARDSAGLIRLAGRFHLRLAELTENPLLQGFVRGL
FT                   VARASLDIALNKGAVYTAEACAAQRALLDALEDGDSAAAAALMDAYLRGLFARMRFLPP
FT                   PTTDLREAFGMKAPRGEKRRRA"
FT   gene            139831..140241
FT                   /locus_tag="PA14_01490"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0122"
FT   CDS_pept        139831..140241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01490"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15079"
FT                   /db_xref="GOA:A0A0H2ZK55"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK55"
FT                   /protein_id="ABJ15079.1"
FT                   /translation="MAYAEWIAVKVVVSKSIGTVGIRNATLQWGKFYRYTNKDDEISTE
FT                   EVSSMNVQAGSPQWIASCGRENASSGTQGSFDCYDGNTKMGTFSWDDPWKSGATNTWGF
FT                   TPASADYAGITSGGNATGTDIGEVTLTLGRFS"
FT   gene            complement(140273..141181)
FT                   /locus_tag="PA14_01500"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0123"
FT   CDS_pept        complement(140273..141181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01500"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15080"
FT                   /db_xref="GOA:A0A0H2ZK53"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK53"
FT                   /protein_id="ABJ15080.1"
FT                   /translation="MDSLKGMAIFATVVDKGSMAAAAQSLGMTPSAVSQQIRKLESRAQ
FT                   VTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGFSG
FT                   TLITQALKPLLENHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGDWSS
FT                   VLCAAPAYLRQRAPINRPEQLTEVDWISLNTSNHLNHLTLSGPGGEVCKLRLEPRVAAN
FT                   GMLAVRQFTLDGLGVSYQPLPEVRDALNDGRLQQLLPEWRIPGLGIYAVTPRREAQPAK
FT                   VKVAIEALRRAFATDGDERWS"
FT   gene            complement(141481..141762)
FT                   /locus_tag="PA14_01510"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0124"
FT   CDS_pept        complement(141481..141762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01510"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15081"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD2"
FT                   /protein_id="ABJ15081.1"
FT                   /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQ
FT                   VANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKEIQILRIDRVEITP"
FT   gene            complement(141759..141986)
FT                   /locus_tag="PA14_01520"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0125"
FT   CDS_pept        complement(141759..141986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01520"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15082"
FT                   /db_xref="GOA:A0A0H2ZJU8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR036535"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU8"
FT                   /protein_id="ABJ15082.1"
FT                   /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQW
FT                   QVAAIDEGLADANAGRLLEHAEIEKRWGLQ"
FT   gene            complement(142162..142785)
FT                   /locus_tag="PA14_01540"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0126"
FT   CDS_pept        complement(142162..142785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ69"
FT                   /protein_id="ABJ15083.1"
FT                   /translation="MPTRVLRGLVAALPLLFLAACSDSAPSSEEIARLLAERGFDKPAC
FT                   ASSTLFKTFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLRRDGDSYDLTPAGREDYKSE
FT                   SKAFCYSSGFDVSVRSVDPAKPDDYGPAVEKGWLVTVEVKPREVKDWAKNPEVLKQASL
FT                   TTLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
FT   gene            142886..143386
FT                   /locus_tag="PA14_01550"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0127"
FT   CDS_pept        142886..143386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01550"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15084"
FT                   /db_xref="GOA:A0A0H2ZK60"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK60"
FT                   /protein_id="ABJ15084.1"
FT                   /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPGQ
FT                   GMEMRFMVKLRVQNPNDEPIEYNGIALNLDVNGQPLASGVSDQTGEVPRFGERVVSVPL
FT                   TVSAFSAFRQAWGLSNNAPTRGMPYVVKGKLAGGLFGTVRFSEKGTLDFSGPAVGAPKT
FT                   KGL"
FT   gene            143458..143799
FT                   /gene="phnA"
FT                   /locus_tag="PA14_01560"
FT   CDS_pept        143458..143799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="PA14_01560"
FT                   /product="putative alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15085"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK57"
FT                   /protein_id="ABJ15085.1"
FT                   /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKV
FT                   IKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMK
FT                   LKSEFVRKV"
FT   gene            complement(143881..145308)
FT                   /gene="gabP"
FT                   /locus_tag="PA14_01580"
FT   CDS_pept        complement(143881..145308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="PA14_01580"
FT                   /product="gamma-aminobutyrate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15086"
FT                   /db_xref="GOA:A0A0H2ZKD7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD7"
FT                   /protein_id="ABJ15086.1"
FT                   /translation="MSKVVLASQLPNKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGSG
FT                   HAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTIGW
FT                   LYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFEFWF
FT                   ALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLTTMFS
FT                   FMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLLIQVGS
FT                   YQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLAKRGDAPSVLKLTNTA
FT                   HVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQLRMRKQLQ
FT                   VSGQPIEFRMWLYPWLTWAVILFIVAALSIMLIMPEHRHEVFATALLTIFTVCLGLLNA
FT                   RRKPRLGEDYAGKTARV"
FT   gene            complement(145477..146970)
FT                   /gene="mmsA"
FT                   /locus_tag="PA14_01600"
FT   CDS_pept        complement(145477..146970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="PA14_01600"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15087"
FT                   /db_xref="GOA:A0A0H2ZJV2"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV2"
FT                   /protein_id="ABJ15087.1"
FT                   /translation="MGTLHHLINGEMVADNGRSADVFNPSTGEAIHKVPLADGKTLQKA
FT                   IDAARAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELKRG
FT                   IENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAI
FT                   ACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKEAVDGLLQAPEVKAISF
FT                   VGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCM
FT                   AISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTGYIDSGV
FT                   AQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVRVNSLEEA
FT                   MQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFGGWKRSLFG
FT                   DLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
FT   gene            complement(147054..147341)
FT                   /locus_tag="PA14_01610"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0131"
FT   CDS_pept        complement(147054..147341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15088"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ72"
FT                   /protein_id="ABJ15088.1"
FT                   /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVPL
FT                   TDGTLLLETPEGDRHAPLVAGQAYFRKAGVEHNVINASAHEVVFVETEIK"
FT   gene            complement(147341..148687)
FT                   /gene="aptA"
FT                   /locus_tag="PA14_01620"
FT   CDS_pept        complement(147341..148687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aptA"
FT                   /locus_tag="PA14_01620"
FT                   /product="beta-alanine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15089"
FT                   /db_xref="GOA:A0A0H2ZK66"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK66"
FT                   /protein_id="ABJ15089.1"
FT                   /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSWL
FT                   TDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIA
FT                   GLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAGTSL
FT                   GGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDASNIAA
FT                   VIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTP
FT                   DLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVACAAGLA
FT                   ALDILARDNLVQQSAELAPHFEKVLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPTVRP
FT                   FEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA"
FT   gene            148823..149740
FT                   /locus_tag="PA14_01640"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0133"
FT   CDS_pept        148823..149740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01640"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15090"
FT                   /db_xref="GOA:A0A0H2ZK61"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK61"
FT                   /protein_id="ABJ15090.1"
FT                   /translation="MAKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRSA
FT                   ISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQHLR
FT                   GELNIGIINNLVTLPQMRITHALSALKGQGPQVRINIGMTTPNEIELGVLDGHLHVGVV
FT                   PLISPLSGLEYLPLYDEHAQLYCSRGHALFERADGDIAVDEVLAADAVAPSYRLPAEAQ
FT                   ARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFHYAIAL
FT                   TIVTRKGRRPNLVLERFLEAVAVS"
FT   gene            complement(149853..151223)
FT                   /gene="guaD"
FT                   /locus_tag="PA14_01660"
FT   CDS_pept        complement(149853..151223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /locus_tag="PA14_01660"
FT                   /product="putative guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15091"
FT                   /db_xref="GOA:A0A0H2ZKE4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE4"
FT                   /protein_id="ABJ15091.1"
FT                   /translation="MNDAVPAGNFVPPLVLRSDHGGSAMSSSAHRGRILHFLGDPAKLG
FT                   DKAWEYFEDGLLWIEHGHVRALDHAAYLLPQLPADLPLEEHPQRLLLPGFVDCHVHYPQ
FT                   LGVIASYGTQLLDWLETHTFPAEQRFADAGYAAAQAELFLDELLRHGTTTALVFGTVHA
FT                   VSAEAFFQAAQKRRLRMIAGKVLMDRNAPPALCDTAASGYAESRALIERWHGNGRLQYA
FT                   VTPRFAPTSSPEQLAAAARLLDEYPGVYLHTHLSENLKEVAWVGELFPQAQDYLDVYHR
FT                   AGLVGERSVFAHGIHLSERECRCLAHKNAALAHCPSSNLFIGSGLFDLGRAQQYGIRVG
FT                   IGSDVGGGTSLSLLANLADAYKIQQLRGTSLDPFQALYLATLGGARALDLDGLVGNFLP
FT                   GREADFVALDLAATPMIAQRMEHARGLADTLFVLNTLGDDRAVAETWVMGERRHAKG"
FT   gene            152381..153952
FT                   /locus_tag="PA14_01670"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0136"
FT   CDS_pept        152381..153952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01670"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15092"
FT                   /db_xref="GOA:A0A0H2ZJV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV6"
FT                   /protein_id="ABJ15092.1"
FT                   /translation="MSAPSSFAPPRLELRGISKRYPGCLANDRIDLCIDAGEIHALLGE
FT                   NGAGKSTLMKIIYGVTRPDAGEIRWQGEPVQVRDPARARALGIGMVFQHFSLFETLSVA
FT                   ENIALALGTEAGSPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLMQDI
FT                   RLLILDEPTSVLTPREAEDLFVTLRRLAEEGCSVLFISHKLAEVRALCQRATVLRGGRV
FT                   AGQCVPAQCSDLELARLMVGDAEGLAAEYPKVTGGAPFLQVRDLHWRNPDPFGVSFAGL
FT                   DLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRAQAERIRLGGCAGAHLAPDARRRA
FT                   GQAFVPAERLGHGAVPEMSLADNALLTAFQQGLVKRGLVRRRKVLALAEEIIRRFAVKA
FT                   PGAGAPARSLSGGNLQKFILGREILQAPRLLVAAHPTWGVDVGAAALIHRALIALRDAG
FT                   TAILVVSEDLDELFLLSDRIAALCSGRLCPAVATASASPQQVGGWMAGQFEAPAAVAGA
FT                   VAQGSL"
FT   gene            153952..155049
FT                   /locus_tag="PA14_01680"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0137"
FT   CDS_pept        153952..155049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01680"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15093"
FT                   /db_xref="GOA:A0A0H2ZJ75"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ75"
FT                   /protein_id="ABJ15093.1"
FT                   /translation="MLLSLEPRGRQSRWMLLASPLLAGLLTLVCGALLFACLGHDPWQT
FT                   LHTVLVQPLSDLYGLGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLVGALAGSAV
FT                   AIQLLDWQSRWALAWVLLAGTAAGALWAGFAAWLRTRFNANEILTTIMLNYIALNLLLY
FT                   GVHGPLKDPDGFNFPQSALFGEASRLPALFEDSRVHLGALFGLLALAAVWVLAQRSFLG
FT                   FQVRVLGLDRRAAGFVGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQVSPGYG
FT                   YAAITVAFLGRLNPFGILCASLLMALLYLGGEAAQMSLNLPLALTGLFQGMMLFFLLAC
FT                   DVLILYRPRLHGRWRKRPALRDALA"
FT   gene            155072..156052
FT                   /locus_tag="PA14_01690"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0138"
FT   CDS_pept        155072..156052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01690"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15094"
FT                   /db_xref="GOA:A0A0H2ZK73"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK73"
FT                   /protein_id="ABJ15094.1"
FT                   /translation="MDIDLLDNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMML
FT                   FGAVIGFMVAFSSGSLWLGVLLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGVGL
FT                   SSFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLLRSR
FT                   AGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMTAG
FT                   RGWIALALVVFASWRVFRVLLGAWLFGLASILHLVAQGIGLSIPANLLAMLPYAATILV
FT                   LVLLSRDALRTRLYAPVSLGQPWKAGALTRAGSSISCFNYLYILR"
FT   gene            156164..156727
FT                   /gene="ahpC"
FT                   /locus_tag="PA14_01710"
FT   CDS_pept        156164..156727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PA14_01710"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15095"
FT                   /db_xref="GOA:Q02UU0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UU0"
FT                   /protein_id="ABJ15095.1"
FT                   /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTF
FT                   NCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPG
FT                   EVCPAKWKEGEKTLAPSLDLVGKI"
FT   gene            156872..158437
FT                   /gene="ahpF"
FT                   /locus_tag="PA14_01720"
FT   CDS_pept        156872..158437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PA14_01720"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15096"
FT                   /db_xref="GOA:A0A0H2ZK64"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK64"
FT                   /protein_id="ABJ15096.1"
FT                   /translation="MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVG
FT                   LTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLD
FT                   ADVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETDGPKLARALEEHVRHYEV
FT                   DIMNLQRASKLVPAKNTGELHEVQFESGGSLKAKTLILATGARWREMGVPGEQEYKAKG
FT                   VCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKL
FT                   YSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLK
FT                   GSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRT
FT                   SAPE"
FT   gene            complement(158517..159413)
FT                   /locus_tag="PA14_01730"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0141"
FT   CDS_pept        complement(158517..159413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15097"
FT                   /db_xref="GOA:A0A0H2ZKF2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF2"
FT                   /protein_id="ABJ15097.1"
FT                   /translation="MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQI
FT                   ELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQ
FT                   WYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLSNSG
FT                   ILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDT
FT                   ADAPWTVIKSDDKKRARLNCIRHFLHALDYPDKDRRIAHEPDPLLVGPASRVIEEDEKV
FT                   YAEAAAAPGHANLDIPA"
FT   gene            159868..161217
FT                   /locus_tag="PA14_01750"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0142"
FT   CDS_pept        159868..161217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01750"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15098"
FT                   /db_xref="GOA:A0A0H2ZJW1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW1"
FT                   /protein_id="ABJ15098.1"
FT                   /translation="MSRTWIRKPLAIFTANGLDAAGGLVVEDGRIVELLGAGQQPAQPC
FT                   ASQFDASRHVVLPGLINTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKLEL
FT                   ATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLGEKD
FT                   GGLPPQQTVQEAETILADSERLIARYHQRGEGARVQIALAPCSPFSVTPEIMRASAELA
FT                   ARHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAEEIRRL
FT                   GEAGTGICHCPSSNMRLASGICPTVELEAAGAPIGLGVDGSASNDASNMILEARQALYL
FT                   QRLRYGAERITPELALGWATRGSARLLGRSDIGELAPGKQADLALFKLDELRFSGSHDP
FT                   LSALLLCAADRADRVMVGGAWRVVDGAVEGLDLAALIARHREAASALIAG"
FT   gene            161387..162376
FT                   /gene="nuh"
FT                   /gene_synonym="iunH"
FT                   /locus_tag="PA14_01760"
FT   CDS_pept        161387..162376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuh"
FT                   /gene_synonym="iunH"
FT                   /locus_tag="PA14_01760"
FT                   /product="nonspecific ribonucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15099"
FT                   /db_xref="GOA:A0A0H2ZJ79"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ79"
FT                   /protein_id="ABJ15099.1"
FT                   /translation="MPASLPLSAAETAAAQSPRTLIIDTDPGADDVIALLFAMASPKEL
FT                   KIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVYAGAPRPLLRTPIYAADVHGSEGI
FT                   TGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTLAMLGPETNLALALTQAPDIVKGIR
FT                   EIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVLKSGAPITMLPLDVTHKILTSPERIA
FT                   KLRNLGNRAGKTVADILDAYVQYDIKYYGLKGGPVHDATVVAYLLKPSLFKGKRINVQV
FT                   DSREGITFGQTVADWYGGLKQPANVEWINEGDAQGFFDLLTERIARLP"
FT   gene            complement(162413..163261)
FT                   /locus_tag="PA14_01770"
FT   CDS_pept        complement(162413..163261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01770"
FT                   /product="putative nucleoside-binding outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15100"
FT                   /db_xref="GOA:A0A0H2ZK78"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK78"
FT                   /protein_id="ABJ15100.1"
FT                   /translation="MRKALLCCAAPLCAAAAFGAENNDENAAREGLWNNLHVYRAFNQR
FT                   GGPYLTDDSYLEWEFGGRKGVLDLYGYIDYKNLFDDASSDVPDGENWFVDIEPRLSIDR
FT                   LLGRDFSIGPIREWFVAFDYYYADARQGPGLNVLWSGIGTNTELPWLGTVGLNLYARYI
FT                   DKNYGASNENAWDGYVAHMNWFKPLAQFGGKRFIAFQGFFDYEFGSKLPDKDDAFEREY
FT                   RTDNGFQAYLGLWYHTEHWKFGYGAKVYRNMTQWRDGEQLDGRRTDSSGIGHYFNVGYA
FT                   F"
FT   gene            complement(163296..163922)
FT                   /locus_tag="PA14_01780"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0144"
FT   CDS_pept        complement(163296..163922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01780"
FT                   /product="putative nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15101"
FT                   /db_xref="GOA:A0A0H2ZK69"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK69"
FT                   /protein_id="ABJ15101.1"
FT                   /translation="MSRSNGSSSRRTFLRLAALLLPAGALLGSLPGVRAAARPRKLYLA
FT                   GPDVFRADAVAHGEALKALCARYGFEGLYPLDNALPKQLAEPREQAAWIYRANIGLIER
FT                   ADAVLANLNFFRGAEPDSGTAFEVGYATALGKPVYGYVDDAGSYAERIRRHAPELVGED
FT                   PTRDRDGMALEEFGLPLNLMLAVPGRIVVGDAEQALRQLAGQSRG"
FT   gene            complement(164072..164590)
FT                   /locus_tag="PA14_01790"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0145"
FT   CDS_pept        complement(164072..164590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01790"
FT                   /product="putative nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15102"
FT                   /db_xref="GOA:A0A0H2ZKF7"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF7"
FT                   /protein_id="ABJ15102.1"
FT                   /translation="MTAIYLAGPDVFRPDAEAHGEMLKALCAEFGFLGLYPLDHALPAD
FT                   IREPAAQAAWVYRANVGLIERADCVLANLEPFRGSEPDSGTAFEVGYALALGKPVYAYL
FT                   SDAGAYAERLARLAPEWLGERPGEDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREALRR
FT                   LAEELGGNA"
FT   gene            164828..165925
FT                   /locus_tag="PA14_01800"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0146"
FT   CDS_pept        164828..165925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01800"
FT                   /product="putative basic membrane protein (bmp)"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15103"
FT                   /db_xref="GOA:A0A0H2ZJW7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW7"
FT                   /protein_id="ABJ15103.1"
FT                   /translation="MKHRPTQSRMSVLRRLAVVLGLGACALAAEAAEPLKIGFVYVGPV
FT                   GDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTSFG
FT                   YMNPTAKVARQFPKVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKIGYI
FT                   ASFPIPEVIRDINAIQLALDKYDPQAELKVMWVSTWFDPGKEADAANALIDQGVDVVFQ
FT                   HTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMDGTWKS
FT                   EDFWGGLAESTVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSGKERFAA
FT                   GVSATNADLASMNYYVEGIKADLPK"
FT   gene            165998..166960
FT                   /locus_tag="PA14_01810"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0147"
FT   CDS_pept        165998..166960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01810"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15104"
FT                   /db_xref="GOA:A0A0H2ZJ83"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ83"
FT                   /protein_id="ABJ15104.1"
FT                   /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPLP
FT                   AARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFDMA
FT                   LHLPAEHPDVRAGKSFYGPNRHPDLPGWEALLEGHYVDMLALARTVLRALAIALGIEED
FT                   FFDRRFEQPVSVFRLIHYPPAAARQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQNRQG
FT                   EWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVISPRGVHRYSMPFFAEPHMDTEIR
FT                   CLPGCFDADNPPKYPPTTCGEWLTSRFAQTYAYRRGETA"
FT   gene            167065..168015
FT                   /gene="add"
FT                   /locus_tag="PA14_01830"
FT   CDS_pept        167065..168015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="PA14_01830"
FT                   /product="putative adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15105"
FT                   /db_xref="GOA:Q02UT0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UT0"
FT                   /protein_id="ABJ15105.1"
FT                   /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETL
FT                   RKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTD
FT                   RGIPFEVVLAGIRAALQDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAV
FT                   GLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRA
FT                   FEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFG
FT                   GYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
FT   gene            168212..168757
FT                   /locus_tag="PA14_01840"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0149"
FT   CDS_pept        168212..168757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01840"
FT                   /product="putative sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15106"
FT                   /db_xref="GOA:A0A0H2ZK85"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK85"
FT                   /protein_id="ABJ15106.1"
FT                   /translation="MPADGEAARRADLLKAFLAQRQRMESLVSRWVGCRATAADLVQEL
FT                   FLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDDWLPEQRQGEPVGPEQA
FT                   LEAGDQWRRVEAALRGLPERTRRIFLLNRIHGRTYAEIAQAMQLSQSAVEKHMMRALDA
FT                   CKASLAGPAGEQARSAQP"
FT   gene            168754..169749
FT                   /locus_tag="PA14_01860"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0150"
FT   CDS_pept        168754..169749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01860"
FT                   /product="putative transmembrane sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15107"
FT                   /db_xref="GOA:A0A0H2ZK74"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK74"
FT                   /protein_id="ABJ15107.1"
FT                   /translation="MTRPDSDAAPYDPVLEQTAQVWLVRLRGTPDAATRRAFEDWLAQR
FT                   PAHAEAYARAEALWRLTEIPASRLAIEEADALEAYLRPRRASRNPRRWAYPLASVACLL
FT                   AMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQRRV
FT                   ELLRGAAALRVKRDTLPFVVEAGEGRARVLGTEFEVRRGAGATRVTVLQGRVAVSAGTG
FT                   AGAAEEVLSAGQQVGFADGRLGRPVAIDAAAALAWRQGWLSFYRRPLAEVLDELARYYP
FT                   GRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
FT   gene            169897..172284
FT                   /locus_tag="PA14_01870"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0151"
FT   CDS_pept        169897..172284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01870"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15108"
FT                   /db_xref="GOA:A0A0H2ZKG6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG6"
FT                   /protein_id="ABJ15108.1"
FT                   /translation="MTPFPRFALRTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLAQ
FT                   ALNAFSRASGQTLLYTAELPPQATAPALHGSLDAEEALQRLLQGSGLRARRIDERTLTL
FT                   EPIPASGALDLDATTVSAAAPAQGYRPAANASISRGDAPLLEIPQAISVVPAQALQDQR
FT                   PRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTATADH
FT                   VEVLKGPASLLYGIQDPGGVVNVVSKKPQLQQANALTLRGSAYAHGRNGSGGQLDSTGP
FT                   LGDSGLAYRMILDHEDEDYWRDFGKSRETLVTPSLAWYGEDTTVNLSYEHREFTTPFDR
FT                   GTAIDPRTNRPLDIPRSRRLDEPFNITEGRSELTRLDLERQLDDTWKAHFGYGYSRETY
FT                   DDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGTLQLAGMQHDLQFGMDHEKR
FT                   KIFRADLLRDSKTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYFQDSIHLDER
FT                   WILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSLYGSYTRSFKP
FT                   NSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRKKNVLVNELDGA
FT                   GNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLAAEVTEDPTLEGKRLQNVARNT
FT                   ASLSAVYELGQLFGGDRLRLGGGARYVGKRPGDPANSFDLPSYTVADAFASYDTRFGGH
FT                   GVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQLSTTVEF"
FT   gene            172662..173489
FT                   /gene="pcaQ"
FT                   /locus_tag="PA14_01890"
FT   CDS_pept        172662..173489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="PA14_01890"
FT                   /product="transcriptional regulator PcaQ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15109"
FT                   /db_xref="GOA:A0A0H2ZJX2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX2"
FT                   /protein_id="ABJ15109.1"
FT                   /translation="MAVSQPAISKTLKELEEILGARLFERSKAGAELTEAGVTFLRYAG
FT                   PCVQALRDGVNTLRGHEAQVETVRVGVLSTVESLVVPEVIRRLHRRHGALVVSVATGPS
FT                   AYLLAQLKVGELDLVVGRMTDSPDIQGLTFEHLYSESMMLVVRPGHPLLAAPLGVLQRL
FT                   AEFPLVLPLAGTTIRRHADSLFVQWGIPLAGQRLETLSPTLSRSYVLRSEAIWVAPRDA
FT                   VRLDVGNGELAELDLGIREPGGSVGLCHNAALPLPLGAQWFSAVLREVAAELH"
FT   gene            173624..174343
FT                   /gene="pcaH"
FT                   /locus_tag="PA14_01900"
FT   CDS_pept        173624..174343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="PA14_01900"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15110"
FT                   /db_xref="GOA:A0A0H2ZJ87"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ87"
FT                   /protein_id="ABJ15110.1"
FT                   /translation="MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLS
FT                   ETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQAN
FT                   AGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIH
FT                   VSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAY
FT                   RFDIVLRGQRKTFFENA"
FT   gene            174354..174959
FT                   /gene="pcaG"
FT                   /locus_tag="PA14_01910"
FT   CDS_pept        174354..174959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="PA14_01910"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15111"
FT                   /db_xref="GOA:A0A0H2ZK90"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK90"
FT                   /protein_id="ABJ15111.1"
FT                   /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREGA
FT                   PGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPERPFNSFGRTATTFDAGE
FT                   WTLHTVKPGVVRNAQGVPMAPHINVSLFARGINIHLQTRLYFDDETEANAACPVLNLIE
FT                   QAPRRDTLLARRCEVDGQLAYRFDIRIQGDNETVFFDF"
FT   gene            175175..176014
FT                   /gene="pcaR"
FT                   /locus_tag="PA14_01930"
FT   CDS_pept        175175..176014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="PA14_01930"
FT                   /product="transcriptional regulator PcaR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15112"
FT                   /db_xref="GOA:A0A0H2ZK80"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK80"
FT                   /protein_id="ABJ15112.1"
FT                   /translation="MSELPEHSATLAPPTVLSPAKRIKAFTGDPNFMTSLARGLAVIHA
FT                   FQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGHAYLS
FT                   STPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGSRLPAY
FT                   CTSMGRILLAALDDDALHAYFGGVEMQAKTSRTLYTPETLLPCLVEIRRQGWCIVDQEL
FT                   EVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELESRFLPLLLEASRELSARLFT"
FT   gene            176167..177318
FT                   /locus_tag="PA14_01940"
FT   CDS_pept        176167..177318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01940"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15113"
FT                   /db_xref="GOA:A0A0H2ZKH1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH1"
FT                   /protein_id="ABJ15113.1"
FT                   /translation="MSDARGAFHSKGRWSRMALPAILCASLLVGCGAEPPAEEHVRVLA
FT                   QTVKMAEFASATSITGDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQ
FT                   RSNVENAQAAVAAQQAQSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSLKAA
FT                   QAQLANARDLLSYTELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYES
FT                   LFSHDVDGQRITVSLLGKPEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEMSLGSV
FT                   VNASVAAPAAHSVVLPWSALSKVGEQPAVWLLDQESKVRLQPVRVARYASEKVVIDGGL
FT                   EAGQTVVTVGGQLLHPGQVVEVAQPPQPTQSTASRDAVGGGQP"
FT   gene            177315..178385
FT                   /locus_tag="PA14_01960"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0157"
FT   CDS_pept        177315..178385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01960"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15114"
FT                   /db_xref="GOA:A0A0H2ZJX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX6"
FT                   /protein_id="ABJ15114.1"
FT                   /translation="MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLG
FT                   RFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLA
FT                   SAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLS
FT                   YTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFL
FT                   VSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVR
FT                   SVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGV
FT                   NSLKPGQKIKLDEDAR"
FT   gene            178382..181429
FT                   /locus_tag="PA14_01970"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0158"
FT   CDS_pept        178382..181429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01970"
FT                   /product="putative RND efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15115"
FT                   /db_xref="GOA:A0A0H2ZJ93"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ93"
FT                   /protein_id="ABJ15115.1"
FT                   /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSFA
FT                   IKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDTTK
FT                   AGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLRDYV
FT                   EKVRLDIRSVKDLGKVQMIGAQNEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAVTPSG
FT                   VVEAGPERISVRTSGNFRSEKDLQAVNLRVNDRFYRLSDLASISRDFVDPPTSLFRYKG
FT                   EPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKAVGGFTQ
FT                   ALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSLGALIIAL
FT                   GLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFVPIGLNASS
FT                   AGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKGRIAERFDSLLH
FT                   LAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQNSSIHETRAVM
FT                   DRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTKDLEARERVAAR
FT                   LRDRLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMGLAGVLDGNPNIG
FT                   DIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVTQVRDDIYLVNVIG
FT                   RAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWRRDRKPTITVKASLR
FT                   GEIQPTDLVAKLAPEVKRFADGLPANYRIEVGGTVEESGKAEGPIAKVVPLMLFLMATF
FT                   LMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILGILALIGIIIRNSVILV
FT                   TQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGI
FT                   VAATLLTLIFLPALYVAWYRIPEPGR"
FT   gene            181628..182566
FT                   /locus_tag="PA14_01980"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0159"
FT   CDS_pept        181628..182566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01980"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15116"
FT                   /db_xref="GOA:A0A0H2ZK95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK95"
FT                   /protein_id="ABJ15116.1"
FT                   /translation="MDTLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHLQ
FT                   TRLLHRTTRRLALTEAGERYLERCRGILEDIEVAEAEAAGAHIRPCGRLRVQSLMGMGQ
FT                   HHLVPMIARYGALFPDVVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLGSIH
FT                   SVLCASPGYLQQHGVPRSVDDLERHVCLRLQDPAYPEGWIFADEQGERTVSPQNTFMVN
FT                   VAEVMAQAAKADLGIALLPSYVAAAALRNGELLRVLPGHAMHERTIYALYPSRRYLDAK
FT                   IRTWVDLLQQELPQAFARDETTMQSSSYWAQ"
FT   gene            182682..182867
FT                   /locus_tag="PA14_01990"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0160"
FT   CDS_pept        182682..182867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK84"
FT                   /protein_id="ABJ15117.1"
FT                   /translation="MNRQILAAAILSLFSLAFSQAGFAEESSLMTNRMVDANQQAIEHQ
FT                   QELSASAAQAGARSDS"
FT   gene            183147..183299
FT                   /locus_tag="PA14_02010"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0161"
FT   CDS_pept        183147..183299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH6"
FT                   /protein_id="ABJ15118.1"
FT                   /translation="MESLKPDESKRLSIEESDCVPTGFQCPEIHWQDFPTPNFDCSYST
FT                   SSQGR"
FT   gene            183454..184788
FT                   /locus_tag="PA14_02020"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0162"
FT   CDS_pept        183454..184788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02020"
FT                   /product="putative outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15119"
FT                   /db_xref="GOA:A0A0H2ZJY0"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY0"
FT                   /protein_id="ABJ15119.1"
FT                   /translation="MRNLFALTPMALALCTASAAWADEGEAKEGFIEGSSLQLLTRNYY
FT                   FNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTSIL
FT                   PITAPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTF
FT                   RGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGGTWGG
FT                   IEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNN
FT                   TYSLHFAVGYKQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQ
FT                   YDYDFVALGLPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYV
FT                   VQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF"
FT   gene            complement(184817..185614)
FT                   /locus_tag="PA14_02030"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0163"
FT   CDS_pept        complement(184817..185614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02030"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15120"
FT                   /db_xref="GOA:A0A0H2ZJA0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJA0"
FT                   /protein_id="ABJ15120.1"
FT                   /translation="MTMNGQPAELHRPIPTLARLPRPVYARAESLRAGSWTSRHRHAWV
FT                   QLSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAWAP
FT                   TRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPMPRE
FT                   PRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRLLASL
FT                   NALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
FT   gene            185692..187308
FT                   /locus_tag="PA14_02050"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0164"
FT   CDS_pept        185692..187308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02050"
FT                   /product="putative gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15121"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA0"
FT                   /protein_id="ABJ15121.1"
FT                   /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGGN
FT                   AIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAAGH
FT                   ERMPLYGWTPVTVPGCPAAWAELSRRFGKLPFEQLLRPAIELARDGFPVSPVIARLWQS
FT                   GLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESFYRGE
FT                   LARTIVGHAERSGGYLRAEDLAGYQAKWVEPISLNYRGYDVWEIPPSGQGLIALMTLNI
FT                   LKGFEFGERDCARTWHRQLEAMKLAYVDGLHYISQPQSMRVSVEELLHVDYAASRRALI
FT                   GERALDPSPGQPKPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIALQNRGAE
FT                   FSLDPDHVNCLEPGKQTFHTIIPGFLSKDGVPLGPFGVMGAYMQPQGHVQMVMNLVDFG
FT                   LNPQAALDAPRWQWLGGLRVGIEHAAPRALAAELAQRGHQVEIAYDSTSYGRGQIVLRD
FT                   PASGVLCGGTEPRTDSQIAVW"
FT   gene            187980..188816
FT                   /locus_tag="PA14_02060"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0165"
FT   CDS_pept        187980..188816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02060"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15122"
FT                   /db_xref="GOA:A0A0H2ZK89"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK89"
FT                   /protein_id="ABJ15122.1"
FT                   /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESL
FT                   TYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITP
FT                   RLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYR
FT                   KPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLH
FT                   FNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF"
FT   gene            189058..190464
FT                   /locus_tag="PA14_02070"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0166"
FT   CDS_pept        189058..190464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02070"
FT                   /product="putative xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15123"
FT                   /db_xref="GOA:A0A0H2ZKI1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI1"
FT                   /protein_id="ABJ15123.1"
FT                   /translation="MHSEDQRPNDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPLV
FT                   IGSLLGLGEHLPYLISMALMVSGAGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAAGM
FT                   LVKQRGGGPEEILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVSLIK
FT                   VGITDLGGGAGATDFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVIGLALGTLAAW
FT                   ATGLFVPRALPELPLVSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTANCMLSR
FT                   QPLEGPAYLQRLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRHVGIYIG
FT                   GVLLALGLFPWIGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTAMDRRSVLIIAAS
FT                   FGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGITAILLNLLLPEERVAEAAQASAKGG
FT                   ALARWRKPLG"
FT   gene            190557..191222
FT                   /locus_tag="PA14_02090"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0167"
FT   CDS_pept        190557..191222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02090"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15124"
FT                   /db_xref="GOA:A0A0H2ZJY4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY4"
FT                   /protein_id="ABJ15124.1"
FT                   /translation="MTLTVPAHDPAARDKPAGRIRQKNEEAILAAAEEEFARHGFKGTS
FT                   MNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDSTFNTLCVDDDPAEALARYIR
FT                   AKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMDPVD
FT                   PVHLIFLLWGSTQHYADFASQIGLVTGRKRMSRQDFAAAADNLVRIILKGCGLTPPAA"
FT   gene            191228..191818
FT                   /locus_tag="PA14_02100"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0168"
FT   CDS_pept        191228..191818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15125"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJA5"
FT                   /protein_id="ABJ15125.1"
FT                   /translation="MPSTLQGLAEYREEIRKSRFHTIAAPVADEDEAQAFIAAHRDASA
FT                   GHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVVVLVSRWFGGIKLGTGGL
FT                   ARAYGGGAAKCLQQAPRSELVERCRVRFACAFADHALLKARSLALGASVAAEDYGADGV
FT                   VLTLELPVARFEALQALLVDLSRGQVRPQRLDA"
FT   gene            complement(191825..192532)
FT                   /locus_tag="PA14_02110"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0169"
FT   CDS_pept        complement(191825..192532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02110"
FT                   /product="putative GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15126"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA5"
FT                   /protein_id="ABJ15126.1"
FT                   /translation="MRLERIARISDGFQSMAREQNLSLSERYHKQLRRLEKVARISDRY
FT                   QQMMRDLNLALKEASIRDPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQ
FT                   VNDTWGHDSGDRVLVEIARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVR
FT                   DSVRTLAVRVGTEALSVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAL
FT                   PPLPAPSRPAPAR"
FT   gene            complement(192659..193039)
FT                   /locus_tag="PA14_02130"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0170"
FT   CDS_pept        complement(192659..193039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15127"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UQ8"
FT                   /protein_id="ABJ15127.1"
FT                   /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDW
FT                   VERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNERV
FT                   AELAEEFREDCSFPFAIQAHDE"
FT   gene            complement(193066..193608)
FT                   /locus_tag="PA14_02140"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0171"
FT   CDS_pept        complement(193066..193608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK93"
FT                   /protein_id="ABJ15128.1"
FT                   /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHAE
FT                   QAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLVER
FT                   DDGQSLVRSIQAIANLDKAALKAAYKEQLRRPRDSGCASGAGLGLLDIARKSSEPLAAS
FT                   LKEQPDGRAFFSLRAVI"
FT   gene            complement(193617..195608)
FT                   /locus_tag="PA14_02150"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0172"
FT   CDS_pept        complement(193617..195608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02150"
FT                   /product="putative serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15129"
FT                   /db_xref="GOA:A0A0H2ZKI5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI5"
FT                   /protein_id="ABJ15129.1"
FT                   /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLAY
FT                   AKNFTLLHRQKILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRGDF
FT                   RDHAYFIIASGSQHYYFNDGSQPYSERPRYTLEAGDPEDAWYFNTLRNSAAYNINVNVD
FT                   SKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGAIQAH
FT                   PDRRLIAYSSAAGGASERHRVFDLLDQPEQRDALREAMRLARAKAGSVHCLWAGLDGRQ
FT                   QLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYAVERLLL
FT                   RPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELEDKVQERT
FT                   QALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKPRDVVGGDF
FT                   YVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAILGETDQAMR
FT                   SMLSQEQIPQALATNMDAGLVWVDRRRRQLAFAGAKISLYASDGEEVQELKGARRAIGD
FT                   KRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLRDHARQPLPEQA
FT                   EAFVATLAEYQGEHPQRDDITILSFRFD"
FT   gene            complement(195871..196920)
FT                   /gene="cheB"
FT                   /locus_tag="PA14_02180"
FT   CDS_pept        complement(195871..196920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="PA14_02180"
FT                   /product="glutamate methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15130"
FT                   /db_xref="GOA:A0A0H2ZJY9"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY9"
FT                   /protein_id="ABJ15130.1"
FT                   /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIK
FT                   QYAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVDFI
FT                   AKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIALGAS
FT                   TGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPG
FT                   HALVAPGDHHMEVQRSGANYVVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTG
FT                   MGKDGARGLLAIRQAGGYTLAQDEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQA
FT                   ARRGSGNRL"
FT   gene            complement(196940..197542)
FT                   /gene="cheD"
FT                   /locus_tag="PA14_02190"
FT   CDS_pept        complement(196940..197542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="PA14_02190"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15131"
FT                   /db_xref="GOA:A0A0H2ZJB1"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJB1"
FT                   /protein_id="ABJ15131.1"
FT                   /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASGEDLVIVTVLG
FT                   SCVSVCLRDPLNGIAGMNHFMLPERGLGGDPASPSARYGSHAMELLINRMLALGANRER
FT                   LQAKVFGGGSVLRQISAAIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGR
FT                   VLVKSLVELKNDTVLQRERDYRRRIDRNADGGPIDLF"
FT   gene            complement(197548..198390)
FT                   /gene="cheR"
FT                   /locus_tag="PA14_02200"
FT   CDS_pept        complement(197548..198390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="PA14_02200"
FT                   /product="putative chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15132"
FT                   /db_xref="GOA:A0A0H2ZKB0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB0"
FT                   /protein_id="ABJ15132.1"
FT                   /translation="MPTSTPSPVFGNQEFHYTREDFQQVRERLYRLTGISLAESKAQLV
FT                   YSRLSRRLRLLRLGSFAEYFTHLDREPGEQQLFVNALTTNLTAFFRERHHFPLLADLAR
FT                   RQLQRHRPLRIWSAAASTGEEPYSIAITLVEALGSFDPPVKIVASDIDTGVLDCARLGV
FT                   YPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWSIAGELDA
FT                   IFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRPVGQTVYSPA"
FT   gene            complement(198460..200499)
FT                   /locus_tag="PA14_02220"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0176"
FT   CDS_pept        complement(198460..200499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02220"
FT                   /product="putative chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15133"
FT                   /db_xref="GOA:A0A0H2ZK98"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR041395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK98"
FT                   /protein_id="ABJ15133.1"
FT                   /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLY
FT                   DSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGV
FT                   NELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRGAAEATS
FT                   AQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDA
FT                   GRLLGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAV
FT                   QWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEEAGKEGFFLRLAKDLNSLVDTADRGLR
FT                   DVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNETALSLSRMLGQIREAADTINTAAS
FT                   EIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANASEVATQGG
FT                   TVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAIRRVTDIMSEI
FT                   AAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGLLNQSVAVFRLD
FT                   TPPSVVQLASARPSAPRPSAPAPLARSGMARASKARKEDGWEEF"
FT   gene            complement(200535..201020)
FT                   /gene="cheW"
FT                   /locus_tag="PA14_02230"
FT   CDS_pept        complement(200535..201020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="PA14_02230"
FT                   /product="putative purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15134"
FT                   /db_xref="GOA:A0A0H2ZKI9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI9"
FT                   /protein_id="ABJ15134.1"
FT                   /translation="MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAI
FT                   ANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSD
FT                   VIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAAA"
FT   gene            complement(201007..202926)
FT                   /gene="cheA"
FT                   /locus_tag="PA14_02250"
FT   CDS_pept        complement(201007..202926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="PA14_02250"
FT                   /product="putative two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15135"
FT                   /db_xref="GOA:A0A0H2ZJZ1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ1"
FT                   /protein_id="ABJ15135.1"
FT                   /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIFR
FT                   AAHSIKGSSGMFGFDDITAVTHELETLLDRIRCGQMHLRPDMISSFLEARDVLQRLLDA
FT                   HRSGRPDPGVPLLETVERLRGWLRAPEQEAAEEGFGLFDDAPARETADDDAFGFFDEGP
FT                   GAPERAAAPEAFGLFDEAPGAPAASEAFGLFDDAPGSPPTEERAFGLFDGAPGSPAAPS
FT                   APAQAVAAPARGAVAPVRGDGESGSIRVSVEKIDSLINLVGELVITQAMLGQLGEQLDP
FT                   SRHERLQHALAQLEHNTRDLQESVMSIRMLPINFIFSRFPRLVRDTATRLGKQVELHLH
FT                   GEHTELDKSVIEKLSDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKLAASHQGGSVV
FT                   VEVSDDGRGLSRPRILAKARERNLPVHDGMSDAEVWQLVFMPGFSTAETVTELSGRGVG
FT                   MDVVKRNIGAMGGRIDIDSAPGMGTRIGIRLPLTLAILDGLIVAVEAVNYVIPLTYIVE
FT                   SLQARSDDVRGLGGEDNAMIRVRGEYLPLFSLHELLRIGGEAPAPEQGIVVILESEGRS
FT                   FALQVDELVGQQQVVIKSLEQNFRRVEGIAGATIMGDGSVALILDVDALPRLAAREDTA
FT                   DERH"
FT   gene            complement(202954..203319)
FT                   /gene="cheY"
FT                   /locus_tag="PA14_02260"
FT   CDS_pept        complement(202954..203319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="PA14_02260"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15136"
FT                   /db_xref="GOA:A0A0H2ZJB8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJB8"
FT                   /protein_id="ABJ15136.1"
FT                   /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQSK
FT                   SYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGWLV
FT                   KPFDPPKLLEVTRKVLP"
FT   gene            complement(203517..204689)
FT                   /locus_tag="PA14_02270"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0180"
FT   CDS_pept        complement(203517..204689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02270"
FT                   /product="putative chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15137"
FT                   /db_xref="GOA:A0A0H2ZKB6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB6"
FT                   /protein_id="ABJ15137.1"
FT                   /translation="MRESLGVSLPSRPLLLKLGLLSLPWALCAGLHAVGLGVWLALALG
FT                   WFASLAMLFLLLRDPRQAVANASPQADAASPAWSAAQRALADETAQLDGHARQIDELLH
FT                   SAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGRGQVDEGINFQDFIRTTQQTLSLFVE
FT                   ATLETSRTSQQLVERMDQVRLKITEILQSTQDMDAIAKQTNLLALNAAIEAARAGESGR
FT                   GFAVVADEVRALSTRSTEFSAAIRKHVDVVHHEIQDAESAISQLADKDMSFALDSKQKI
FT                   QGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVDAAVTALQFQDMGSQLLGQMRKHHARL
FT                   GAFALGLGALEARPRQEWPERVAREVEELRRPLPSPVSQNSVNVGEVELF"
FT   gene            complement(204880..205815)
FT                   /locus_tag="PA14_02290"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0181"
FT   CDS_pept        complement(204880..205815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02290"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15138"
FT                   /db_xref="GOA:A0A0H2ZKA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA4"
FT                   /protein_id="ABJ15138.1"
FT                   /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNLG
FT                   VRLFQRSTRRLTLTEAGERFLQEVGGSLEGIQTALANVSSVGNQPSGTLKVSMGLAFGR
FT                   DYILPLLGEFLERYPDIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPPGVVARNLTPGH
FT                   LILLASPAYLRDKPPIRHPGDLGGFDGIRIRSPQTGRVRSWPLRRRNGEEAPIELRERM
FT                   TMSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAANKLL
FT                   PAKTRVFVDFVVDYFRRQDLARRFSAFPTG"
FT   gene            205932..206684
FT                   /locus_tag="PA14_02300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0182"
FT   CDS_pept        205932..206684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02300"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15139"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ6"
FT                   /protein_id="ABJ15139.1"
FT                   /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSSA
FT                   DKSRALAAELEGAGASILALHADSADAAALVAAVDEAAARFGRIDILVNNAAVLALGSV
FT                   EELPLADFERTLAINVRSVFVATQAAVKHMGDGGRVISIGSTNAERMPFAGGATYAMSK
FT                   SALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAETLKGLMALPRYARSEEI
FT                   ASFVAYLAGPEAAYITGASLTIDGGFSA"
FT   gene            complement(206784..208394)
FT                   /gene="atsA"
FT                   /locus_tag="PA14_02310"
FT   CDS_pept        complement(206784..208394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsA"
FT                   /locus_tag="PA14_02310"
FT                   /product="arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15140"
FT                   /db_xref="GOA:A0A0H2ZJZ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ6"
FT                   /protein_id="ABJ15140.1"
FT                   /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTDF
FT                   HTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELAGKPGYEGHLNERVVALPELLREA
FT                   GYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGTPAL
FT                   YVEDERYLDTLPEGFYSSDAFGDKLLHYLKERDQSRPFFAYLPFSAPHWPLQAPQEIVE
FT                   KYRGRYDAGPEALRQERLARLKELGLVEADVEAHPVLALSREWEALDDEERAKSARAME
FT                   VYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPDLLGFLD
FT                   RHYDNSLENIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYPRLSRQGA
FT                   ISHAFATVMDVTPTLLDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEAAHDENTVT
FT                   GWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPGKLAELIEHW
FT                   KRYVSETGVVEGASPFLVR"
FT   gene            complement(208482..209321)
FT                   /gene="atsC"
FT                   /locus_tag="PA14_02330"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0184"
FT   CDS_pept        complement(208482..209321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsC"
FT                   /locus_tag="PA14_02330"
FT                   /product="putative BC-type transporter, ATP-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15141"
FT                   /db_xref="GOA:A0A0H2ZJC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJC4"
FT                   /protein_id="ABJ15141.1"
FT                   /translation="MNAFTAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGEF
FT                   IAIVGASGCGKSTLLRLLIGLDRDYDGEIRVDGRPIAGIGGERGIVFQEHRLFPWLTVQ
FT                   QNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLVASP
FT                   RLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVMEPRP
FT                   GRIRRVVEVDLAHPRERGGFDFLRQREALLHELTADGEYVAPPPRRVENLPFEFLAC"
FT   gene            complement(209318..210934)
FT                   /gene="atsB"
FT                   /locus_tag="PA14_02340"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0185"
FT   CDS_pept        complement(209318..210934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsB"
FT                   /locus_tag="PA14_02340"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15142"
FT                   /db_xref="GOA:A0A0H2ZKC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC0"
FT                   /protein_id="ABJ15142.1"
FT                   /translation="MKNIDKTLSPAWSRPLPRLAPPPSAAFARRLGDSLLPWLLPLGLA
FT                   LLWWVASHRHWMSAQVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASGAA
FT                   LGAWLGFSPRAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVPVTI
FT                   HTLVGVRDAQPKLREAAAVLRLPPRLLVWRLILPAALPAFLTGLRLALAQGWTSLLAVE
FT                   LLASSEGIGYLMVQGRQLFMLDIVFVCILVIGLVGVGMDRAIQWLDRRLLHWPQAATGE
FT                   FRRRPPGRGWQRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSGALDGSL
FT                   PGALFDSLKRTLGGLLLGGGLGFLGGLLLGLWRPAERFFGPTFAALRQVAIFAWVPLLT
FT                   AWFGLGEPAKLTFVAIAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRRLLRLVLPG
FT                   AAPSVFAGLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIGAGMLLVGLT
FT                   GALLNALGQRIEARATRWRHA"
FT   gene            211201..212262
FT                   /gene="atsR"
FT                   /locus_tag="PA14_02360"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0186"
FT   CDS_pept        211201..212262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsR"
FT                   /locus_tag="PA14_02360"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15143"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA9"
FT                   /protein_id="ABJ15143.1"
FT                   /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVSA
FT                   GSSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLGDL
FT                   AAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLSFDN
FT                   ALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLSTRDLN
FT                   GAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQASYPVV
FT                   ILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRREFSAEQWAAPELLEAAG
FT                   KLAKAKAVAQAAE"
FT   gene            complement(212285..213643)
FT                   /locus_tag="PA14_02370"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0189"
FT   CDS_pept        complement(212285..213643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02370"
FT                   /product="putative outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15144"
FT                   /db_xref="GOA:A0A0H2ZKK2"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK2"
FT                   /protein_id="ABJ15144.1"
FT                   /translation="MQNLRRAVFAGLVAGTLSEGAAATAGDGGFVEDSELQFLARTYYF
FT                   NRDYRDSPNNAGRNRFKPRSERNGYREETTQGLRLQFASGYTPGSLGFGLDAHAMLGLQ
FT                   LDSGGGRTGTGNLPVGADGHPDHRYGKVGGALRLRHGETRLKYGQTTTSAPVFAASSNR
FT                   TLSGMAYGLLLEDRSFDGLLLEGGRFTAASGPGESKVRGDISTVYGRLGAYPVRLDAVG
FT                   FLGGQWQATERLQLSLYASRFDDIWQQAYFGASHRQPLGGERALRVDLDAYRTRDSGQS
FT                   RFGRIDTLASSLALGYEQGPQRITLAYQRVHGEQPFDYMAFGDGRSSASMVLANSVGYS
FT                   DFNGPGERSWQLRYDLDLGALGLPGLSLHALHARGRAGASASSAAESIYAGLYGRDGRH
FT                   RESDLGFAYRVKAGPLAGLALRTSQAWHRGNASYLDGDIDETRLVVDYSRSIW"
FT   gene            213891..214616
FT                   /locus_tag="PA14_02380"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0190"
FT   CDS_pept        213891..214616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02380"
FT                   /product="putative membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15145"
FT                   /db_xref="GOA:A0A0H2ZK00"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK00"
FT                   /protein_id="ABJ15145.1"
FT                   /translation="MNNKTLCPSLLLCLSLLAPLSCLGETAAAPYPLAHPPRLADYLPP
FT                   PPAANSAAAVADLGAVLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGASFDKERLP
FT                   LTRSFFNRAQENLVEVLMPAKKHFARPRPYEVTPKVKPVLPPPEGESYPSGHTMDSYFK
FT                   ASLLSMLVPEHHDAFFARAEEHAQSRVLAGVHFPSDLEGGQTAAAALVASLLADPAVAA
FT                   DFAAVREELRGALGLPKLQ"
FT   gene            complement(214640..215557)
FT                   /locus_tag="PA14_02390"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0191"
FT   CDS_pept        complement(214640..215557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02390"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15146"
FT                   /db_xref="GOA:A0A0H2ZJD1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJD1"
FT                   /protein_id="ABJ15146.1"
FT                   /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELGC
FT                   QLVDRGSKDLRPTPEGQVVLQHALSLVQGSANLIHEIAQLNKLDTGELRFGSGPAPAQQ
FT                   LVPDAVADFINRHPRVQISLDVDNWEKLSRALLREEIEFFVADIRDFEADPNFQTRPLT
FT                   PRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAANIRCE
FT                   NMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGIISRSGY
FT                   RLSAAAKAMIETLVELDQAQHAAA"
FT   gene            215908..218280
FT                   /locus_tag="PA14_02410"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0192"
FT   CDS_pept        215908..218280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02410"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15147"
FT                   /db_xref="GOA:A0A0H2ZKC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC8"
FT                   /protein_id="ABJ15147.1"
FT                   /translation="MKYHYRLPLRRTPPGGSDYALALLLALGGALPASAADAPAPAEEA
FT                   PPLAGSAPAKADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQVL
FT                   PSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIEQLE
FT                   LLRGPQGTLFGKNTTAGVLNISTRAPTFTTERTVEVSGGQDGYFQGRGTVSGPLGETLA
FT                   GRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEEDSSNG
FT                   SMVVYGAAERFWQRAALVGASPLRDPQRKKVNINGRQHVSVHQGGSSLEANWNLAGGYR
FT                   LTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFDYVVGAYA
FT                   FRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQGTWHLSERL
FT                   DFTAGLRGTYEEKNAKVERFAPLGGAAVGGVGAAVRNGQLGAYDSGDLSQYNFAPSALL
FT                   SLSYQFSDDLLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERANDAELGLKSTLF
FT                   DRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLEFEATALPLRGL
FT                   TLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLSGQRVVGASKWIANLNGEYQWR
FT                   LDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSDLGDGQLDTSVWLK
FT                   NAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
FT   gene            218321..219223
FT                   /gene="atsK"
FT                   /locus_tag="PA14_02420"
FT   CDS_pept        218321..219223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsK"
FT                   /locus_tag="PA14_02420"
FT                   /product="putative alkylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15148"
FT                   /db_xref="GOA:A0A0H2ZKB5"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB5"
FT                   /protein_id="ABJ15148.1"
FT                   /translation="MSNAAQALATPVRLDVRPVAGRIGAEIRGVTLSGELDAATVEAIQ
FT                   AALVRHKVIFFRDQSHLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRRAN
FT                   SWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAVHSN
FT                   EYDYAGVKPSASLEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRLKGLS
FT                   QHDSAHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAIDDYGDQPRVVRRVTL
FT                   GGDVPVGIDGQRSRTIRKA"
FT   gene            219291..220190
FT                   /locus_tag="PA14_02435"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0194"
FT   CDS_pept        219291..220190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15642"
FT                   /db_xref="GOA:A0A0H2ZLU3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLU3"
FT                   /protein_id="ABJ15642.1"
FT                   /translation="MSQSATARQPEPEVAEAFRITPLEAPLGAEVRGLDARRPLAPEQV
FT                   LALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPEIVKV
FT                   ANTGDGELGNFALPAHIDHQWTPVPSSGSLLYALEVPSSGGETRFTNLARAYESLDEAT
FT                   RREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRRVLFL
FT                   SAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHARNAFP
FT                   ASERRRLKRISLAGSRPF"
FT   gene            220837..221955
FT                   /locus_tag="PA14_02450"
FT   CDS_pept        220837..221955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02450"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 1"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15149"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK8"
FT                   /protein_id="ABJ15149.1"
FT                   /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNASQ
FT                   PDSAYEAAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIARM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATVAEMKP
FT                   GSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNILDFLKL
FT                   TLNAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
FT   gene            222031..222339
FT                   /locus_tag="PA14_02460"
FT   CDS_pept        222031..222339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02460"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 2"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15150"
FT                   /db_xref="GOA:A0A0H2ZK03"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK03"
FT                   /protein_id="ABJ15150.1"
FT                   /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH"
FT   gene            222339..223775
FT                   /gene="pntB"
FT                   /locus_tag="PA14_02470"
FT   CDS_pept        222339..223775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PA14_02470"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15151"
FT                   /db_xref="GOA:A0A0H2ZJD6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJD6"
FT                   /protein_id="ABJ15151.1"
FT                   /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIAV
FT                   ATTVGLVFKLGAEIATTGVGYIVVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVAHLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAVARAQHA
FT                   LMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQTDV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   gene            224119..224931
FT                   /gene="tonB2"
FT                   /locus_tag="PA14_02490"
FT   CDS_pept        224119..224931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="PA14_02490"
FT                   /product="putative TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15152"
FT                   /db_xref="GOA:A0A0H2ZKD4"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD4"
FT                   /protein_id="ABJ15152.1"
FT                   /translation="MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPAQGRV
FT                   LSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPP
FT                   EPLPPVVEEPPPPVVDENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPPQPA
FT                   APPAPPAPAAAPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSE
FT                   IQVQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVSVPIDFKLN"
FT   gene            224960..225679
FT                   /gene="exbB1"
FT                   /gene_synonym="exbB"
FT                   /locus_tag="PA14_02500"
FT   CDS_pept        224960..225679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /gene_synonym="exbB"
FT                   /locus_tag="PA14_02500"
FT                   /product="transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15153"
FT                   /db_xref="GOA:A0A0H2ZKC1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC1"
FT                   /protein_id="ABJ15153.1"
FT                   /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDR
FT                   QFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLER
FT                   ALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHP
FT                   SAARQAGNPSRNVKEAS"
FT   gene            225681..226082
FT                   /gene="exbD1"
FT                   /gene_synonym="exbD"
FT                   /locus_tag="PA14_02510"
FT   CDS_pept        225681..226082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /gene_synonym="exbD"
FT                   /locus_tag="PA14_02510"
FT                   /product="transport protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15154"
FT                   /db_xref="GOA:A0A0H2ZKL3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL3"
FT                   /protein_id="ABJ15154.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPIN
FT                   LPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQAD
FT                   EGVNYGQVAKAMASIERAGITRLAVITAR"
FT   gene            complement(226263..226475)
FT                   /locus_tag="PA14_02520"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0200"
FT   CDS_pept        complement(226263..226475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15155"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK08"
FT                   /protein_id="ABJ15155.1"
FT                   /translation="MAKKFPLHPSHPERICWGCDRYCSAESMGCGNGASRTQHPSELFG
FT                   EDWAGEWEVEGTEDAKEQEAPARQA"
FT   gene            226691..227272
FT                   /locus_tag="PA14_02530"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0201"
FT   CDS_pept        226691..227272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02530"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15156"
FT                   /db_xref="GOA:A0A0H2ZJE3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJE3"
FT                   /protein_id="ABJ15156.1"
FT                   /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRALPNASRVEQQDWITPL
FT                   RADWIAELDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDQVRGALLVAPADVER
FT                   ESCAEALRNFAPISREPLPFPSVLVGSDNDQACSPQRAMHLARAWGAETVILPEAGHIN
FT                   VKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
FT   gene            227383..229047
FT                   /gene="mdcA"
FT                   /locus_tag="PA14_02550"
FT   CDS_pept        227383..229047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PA14_02550"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15157"
FT                   /db_xref="GOA:A0A0H2ZKD9"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD9"
FT                   /protein_id="ABJ15157.1"
FT                   /translation="MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPRERLVAALEA
FT                   LIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARK
FT                   LDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNV
FT                   YTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSN
FT                   RMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTAAW
FT                   LDMRGEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDD
FT                   VTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDL
FT                   GIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
FT   gene            229047..229928
FT                   /gene="mdcB"
FT                   /locus_tag="PA14_02560"
FT   CDS_pept        229047..229928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="PA14_02560"
FT                   /product="putative Triphosphoribosyl-dephospho-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15158"
FT                   /db_xref="GOA:Q02UM6"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UM6"
FT                   /protein_id="ABJ15158.1"
FT                   /translation="MNAIANLAATLRADLGECLADLAVDALIDEAELSPKPALVDRRGN
FT                   GAHADLHLGLMQASALSLWPCFKEMADAAQRHGRIDARLRGVLGQLGRDGEAAMLRTTE
FT                   GVNTHRGAIWALGLLVAAAALEPRRTQAGEVAARAGRIALLDDPAAAIGDSHGERVRRR
FT                   YGVGGAREEARLGFPRAVRHGLPQLWRSREGGAGEQNARLDALLAIMSVLDDTCVLHRA
FT                   GRVGLAAMQDGARAVLAAGGSASLAGRRRLCELDRRLLALNASPGGAADLLAACLFLDR
FT                   LPAVSGGWAGSL"
FT   gene            229930..230229
FT                   /gene="mdcC"
FT                   /locus_tag="PA14_02570"
FT   CDS_pept        229930..230229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PA14_02570"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15159"
FT                   /db_xref="GOA:Q02UM5"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UM5"
FT                   /protein_id="ABJ15159.1"
FT                   /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVV
FT                   TSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD"
FT   gene            230222..231085
FT                   /gene="mdcD"
FT                   /locus_tag="PA14_02580"
FT   CDS_pept        230222..231085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PA14_02580"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15160"
FT                   /db_xref="GOA:A0A0H2ZKC6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC6"
FT                   /protein_id="ABJ15160.1"
FT                   /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPW
FT                   LERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDN
FT                   RNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGM
FT                   SIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLAD
FT                   AYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLGDLDTAEQPDAAGVRRLYQGL
FT                   GQGDAT"
FT   gene            231082..231888
FT                   /gene="mdcE"
FT                   /locus_tag="PA14_02590"
FT   CDS_pept        231082..231888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PA14_02590"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15161"
FT                   /db_xref="GOA:A0A0H2ZKL8"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL8"
FT                   /protein_id="ABJ15161.1"
FT                   /translation="MSQPFTSRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRFL
FT                   AVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGR
FT                   REEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGV
FT                   MVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTA
FT                   DLVRVRTCLGEALADILGGPRDLGGRLGAANREASAQVRRLLREQW"
FT   gene            231904..232596
FT                   /gene="mdcG"
FT                   /locus_tag="PA14_02610"
FT   CDS_pept        231904..232596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /locus_tag="PA14_02610"
FT                   /product="putative malonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15162"
FT                   /db_xref="GOA:A0A0H2ZK12"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK12"
FT                   /protein_id="ABJ15162.1"
FT                   /translation="MVIANSSQRGSSRRRLAPDPMRRRAGPEPHDLLLGMAPAHLPENA
FT                   PAWVCAALKAGWPVVVRRAPADPARVAIGVRGLVREQRWAGWMPLAAITWRLRPEALGQ
FT                   REPAMLRDLPAWRALRDLRAPLNALGLAWGVTGGAGFELASGVAVLHPDSDLDLLLRTP
FT                   RPFPRDDALRLLQRFEQCPCRIDLQLQTPAGGVALREWAEGRPRVLAKGSEAPLLLEDP
FT                   WRVAEVEA"
FT   gene            232593..233525
FT                   /gene="mdcH"
FT                   /locus_tag="PA14_02620"
FT   CDS_pept        232593..233525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="PA14_02620"
FT                   /product="putative epsilon subunit of malonate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15163"
FT                   /db_xref="GOA:A0A0H2ZJE9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJE9"
FT                   /protein_id="ABJ15163.1"
FT                   /translation="MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAEL
FT                   ESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFDDA
FT                   LRLVALRGELMQAAWPEGYGMSAILGLDQAQLDALILMVRREHPPLYLANVNAERQLVV
FT                   AGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGVRLRRPRVPY
FT                   LSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARP
FT                   LFGCATPAFEGSRADTLDALLREEEKRTR"
FT   gene            233582..233986
FT                   /gene="mdcL"
FT                   /locus_tag="PA14_02630"
FT   CDS_pept        233582..233986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcL"
FT                   /locus_tag="PA14_02630"
FT                   /product="putative malonate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15164"
FT                   /db_xref="GOA:A0A0H2ZKE5"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE5"
FT                   /protein_id="ABJ15164.1"
FT                   /translation="MIIYGVALLSLCTLAGLFIGEILGVLLGVPANVGGVGIAMLLLIF
FT                   VGGYLGKRGLLSAKTEQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAVAV
FT                   AFALVPLLDRFGRKKAEGAPPLKPRTSVQG"
FT   gene            233992..234756
FT                   /gene="mcdM"
FT                   /locus_tag="PA14_02640"
FT   CDS_pept        233992..234756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcdM"
FT                   /locus_tag="PA14_02640"
FT                   /product="putative malonate transporter, MadM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15165"
FT                   /db_xref="GOA:A0A0H2ZKD1"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD1"
FT                   /protein_id="ABJ15165.1"
FT                   /translation="MFESLNKVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSAI
FT                   AIFLGLVLSYVGGVATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELRRA
FT                   GVSGVVSLFLGVGSSFVAGVAVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGASSE
FT                   VMALSIAAGLVKAILVMVLTPFVAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAATDPKL
FT                   VPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
FT   gene            complement(234841..235770)
FT                   /locus_tag="PA14_02650"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0217"
FT   CDS_pept        complement(234841..235770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02650"
FT                   /product="putative malonate utilization transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15166"
FT                   /db_xref="GOA:A0A0H2ZKM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM4"
FT                   /protein_id="ABJ15166.1"
FT                   /translation="MLIDEEITLKKLETFLAFMRTGNLARAAAELGTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLGAL
FT                   YSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSDPDC
FT                   EHLPLFSDDIFLAVPVDSPYARLAEIDLSTLRDTPFVTLTQGFATHQDGTRVFQQAGFE
FT                   PQIAMQVNDIFTLLSMVSSGVGHALLPKRIEAVYENRVRLIPLQPRYRLQQHIGVVFLK
FT                   AKERDPNLLALLAECRMYSLRLEQEAAG"
FT   gene            complement(236099..237019)
FT                   /locus_tag="PA14_02660"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0218"
FT   CDS_pept        complement(236099..237019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02660"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15167"
FT                   /db_xref="GOA:A0A0H2ZK16"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK16"
FT                   /protein_id="ABJ15167.1"
FT                   /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEES
FT                   FGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCFET
FT                   VAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIETEP
FT                   LMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLTPNIA
FT                   FSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVVMVDLAEPVSTSGLAAAWLKRA
FT                   QLTKPARLFVDYCREQLGKLAERRH"
FT   gene            237370..238860
FT                   /gene="aldH"
FT                   /locus_tag="PA14_02680"
FT   CDS_pept        237370..238860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="PA14_02680"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15168"
FT                   /db_xref="GOA:A0A0H2ZJF6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJF6"
FT                   /protein_id="ABJ15168.1"
FT                   /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNRL
FT                   LARVAACDAADVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALLDS
FT                   LNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAQQALATITRVPLGVIGAVV
FT                   PWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGVPEGVLNVVPGLG
FT                   EQAGKALGLHPEVDALVFTGSTEVGKYFMQYSAQSNLKQVWLECGGKSPNLVFADCRDL
FT                   DLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLDPASRAG
FT                   AIVDRRQTAGILAAIERAQGEGATLLGGGRQLTINGSDNFIEPTLFGDVRPDMQLAREE
FT                   IFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGTVSVNTVDA
FT                   LDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
FT   gene            238918..240351
FT                   /locus_tag="PA14_02690"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0220"
FT   CDS_pept        238918..240351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02690"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15169"
FT                   /db_xref="GOA:A0A0H2ZKF1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF1"
FT                   /protein_id="ABJ15169.1"
FT                   /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGTA
FT                   GLGFIVPLGVAYLLALSYAFSFSELALMIPRAGSLSSYTEVAIGHFPAILATFSGYVVV
FT                   AMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALALLM
FT                   MIVLLVLGLGAVSSDHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLVEETR
FT                   RPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGEYGQLF
FT                   LVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFKQLSRRARTPWVAVLFVAAITG
FT                   LPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTPFYPLPQL
FT                   FGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLFVPEPLETA
FT                   GETAQGKSVALDPLQSPSA"
FT   gene            240382..241764
FT                   /locus_tag="PA14_02700"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0221"
FT   CDS_pept        240382..241764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02700"
FT                   /product="putative aminotransferase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15170"
FT                   /db_xref="GOA:A0A0H2ZKD6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD6"
FT                   /protein_id="ABJ15170.1"
FT                   /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGDG
FT                   LQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVELS
FT                   EMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGSTLG
FT                   STALGGMKFMHEMGGMLPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILELGAEN
FT                   VAAFVAEPFQGAGGMIFPPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFG
FT                   FQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAAVAIANL
FT                   KALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDKATRKRFA
FT                   NENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREIG
FT                   VL"
FT   gene            241928..242986
FT                   /locus_tag="PA14_02720"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0222"
FT   CDS_pept        241928..242986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02720"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15171"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN0"
FT                   /protein_id="ABJ15171.1"
FT                   /translation="MYKSLHQYAHVFSRLSLFGLAFAAAAQAQSQSLTVISFGGATKAA
FT                   QEQAYFKPFERSGGGQVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLF
FT                   ERLDPARFGDPAQFVPGTFSECGVATYVWSMVMAYDSTKLARAPQSWADFWNVREFPGK
FT                   RGLRKGAKYTLEVALLADGVKAEDLYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPP
FT                   QWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIA
FT                   FVSQPQTQKVFSEQIPYGPVHKGTLALLPKTVQEALPTAPANLEGARAVDAEFWVDHGE
FT                   ELEQRFNAWAAR"
FT   gene            complement(243064..243945)
FT                   /locus_tag="PA14_02730"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0223"
FT   CDS_pept        complement(243064..243945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02730"
FT                   /product="putative dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15172"
FT                   /db_xref="GOA:A0A0H2ZK20"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK20"
FT                   /protein_id="ABJ15172.1"
FT                   /translation="MSASIHGIIGYTITPFAADGGLDLPALGRSIERLIDGGVHAIAPL
FT                   GSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEAVM
FT                   VLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDNVTM
FT                   VKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCSAAPNLIPTLNGQLY
FT                   QAVLDGDLEKARTLFYRQLPLLDFILRRGLPTTIKAGLGLSGLEVGAPRLPVQALDTEG
FT                   CRYLQGLLEELR"
FT   gene            complement(244005..244787)
FT                   /locus_tag="PA14_02740"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0224"
FT   CDS_pept        complement(244005..244787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02740"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15173"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJG4"
FT                   /protein_id="ABJ15173.1"
FT                   /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEA
FT                   GHDSGLAGQITSRGPEAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRF
FT                   HSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGN
FT                   EEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPI
FT                   PPALAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
FT   gene            244942..245481
FT                   /locus_tag="PA14_02750"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0225"
FT   CDS_pept        244942..245481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02750"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15174"
FT                   /db_xref="GOA:A0A0H2ZKF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF8"
FT                   /protein_id="ABJ15174.1"
FT                   /translation="MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAAA
FT                   LKLAKALNVQVEELFSEESDGVDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARALLP
FT                   FIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHRIRS
FT                   LGETQAELLVVIHSDE"
FT   gene            245632..246483
FT                   /gene="catI"
FT                   /locus_tag="PA14_02760"
FT   CDS_pept        245632..246483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /locus_tag="PA14_02760"
FT                   /product="putative CoA transferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15175"
FT                   /db_xref="GOA:A0A0H2ZKE2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE2"
FT                   /protein_id="ABJ15175.1"
FT                   /translation="MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRKD
FT                   LTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPHPLEIEEHSH
FT                   ADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVI
FT                   HAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWALSAVC
FT                   LVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQAKLAEG
FT                   KR"
FT   gene            246480..247262
FT                   /gene="pcaJ"
FT                   /locus_tag="PA14_02770"
FT   CDS_pept        246480..247262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="PA14_02770"
FT                   /product="putative CoA transferase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15176"
FT                   /db_xref="GOA:A0A0H2ZKN6"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN6"
FT                   /protein_id="ABJ15176.1"
FT                   /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSPD
FT                   VVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQV
FT                   DRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFVTSVG
FT                   HGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEATGWAI
FT                   RFAERVAETPAPSEVELAALRDLEARTAAAHGQKGSDE"
FT   gene            247259..248464
FT                   /gene="pcaF"
FT                   /gene_synonym="catF"
FT                   /locus_tag="PA14_02790"
FT   CDS_pept        247259..248464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /gene_synonym="catF"
FT                   /locus_tag="PA14_02790"
FT                   /product="beta-ketoadipyl CoA thiolase PcaF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15177"
FT                   /db_xref="GOA:A0A0H2ZK25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK25"
FT                   /protein_id="ABJ15177.1"
FT                   /translation="MSREVFICDAVRTPIGRFGGSLSAVRADDLAAVPLKALVERNPGV
FT                   DWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAFRA
FT                   IACGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYGIDP
FT                   MPQTADNVADDYRVSRADQDAFALRSQQRAGRAQAAGFFAEEIVPVTIRGRKGDTLVEY
FT                   DEHPRPDTTLEALARLKPVNGPEKTVTAGNASGVNDGAAALVLASAEAVEKHGLTPRAR
FT                   VLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACLRELGVA
FT                   DDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQGLALAIE
FT                   RV"
FT   gene            248614..249912
FT                   /gene="pcaT"
FT                   /gene_synonym="kgtP"
FT                   /locus_tag="PA14_02810"
FT   CDS_pept        248614..249912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaT"
FT                   /gene_synonym="kgtP"
FT                   /locus_tag="PA14_02810"
FT                   /product="dicarboxylic acid transporter PcaT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15178"
FT                   /db_xref="GOA:A0A0H2ZJH2"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJH2"
FT                   /protein_id="ABJ15178.1"
FT                   /translation="MTAPVHQYSNEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYFA
FT                   PAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAGSL
FT                   AIACMPTYASIGTLAPALLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASFQYV
FT                   TLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETASKST
FT                   LERKESGTFAELFKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKTASAVM
FT                   TFALLAYMLMQPLFGMLSDRIGRKTSMLWFGTLGTLCTLPILLALKTVSSPYMAFFLII
FT                   LALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALGLKSVGMEN
FT                   VFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
FT   gene            249935..251314
FT                   /gene="pcaB"
FT                   /locus_tag="PA14_02830"
FT   CDS_pept        249935..251314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="PA14_02830"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15179"
FT                   /db_xref="GOA:A0A0H2ZKG5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG5"
FT                   /protein_id="ABJ15179.1"
FT                   /translation="MSDVPANQLFDAYFTAAPMRAVFSDRGRLQGMLDFEAALARAEAR
FT                   TGVVPATAVAPIESACRAELYDPLALAEAVATAGNSAIPLVKALGRQVAAGDAAAERYV
FT                   HLGATSQDAMDSGLVLQLRRALALLEQDLQRLAEVLADQAERHADTPLAGRTWLQHATP
FT                   VTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALDEQALPVAAALAEELG
FT                   LALPEQPWHTQRDRLVEFASVLGLVAGSLGKFGRDVSLLMQTEAGEVFEPAGAGRGGSS
FT                   TMPHKRNPVSSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPELCCLVSG
FT                   ALQQAIGLLEGLEVDAQRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLVEQCCRRA
FT                   VEQRRELRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHHALGFEPHP
FT                   A"
FT   gene            251329..252120
FT                   /gene="pcaD"
FT                   /locus_tag="PA14_02840"
FT   CDS_pept        251329..252120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="PA14_02840"
FT                   /product="beta-ketoadipate enol-lactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15180"
FT                   /db_xref="GOA:A0A0H2ZKE7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE7"
FT                   /protein_id="ABJ15180.1"
FT                   /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPALT
FT                   AHFRVLRYDTRGHGASLVTPGPYAIGQLGADVLALLDALDLPRVHFCGLSMGGLIGQWL
FT                   GIHAGERLGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASVARWFTAGFAE
FT                   REPAQVERIVAMLAATSPQGYAANCAAVRDADFREQLGLVQAPTLIVAGSHDAVTTPDN
FT                   ARFMQARIADAQLVEFAAAHLSNVEAGDAFSRRLVDFLLSA"
FT   gene            252131..252532
FT                   /gene="pcaC"
FT                   /locus_tag="PA14_02850"
FT   CDS_pept        252131..252532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="PA14_02850"
FT                   /product="gamma-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15181"
FT                   /db_xref="GOA:A0A0H2ZKP2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP2"
FT                   /protein_id="ABJ15181.1"
FT                   /translation="MDEKQRYEAGMQVRRAVLGDAHVERSLANLTPFNEEFQEMITRHA
FT                   WGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLSAAKNNGVSRDEIKEVIMQSAIY
FT                   CGIPAANATFHLAESVWDELGVESQQTSR"
FT   gene            252660..253601
FT                   /locus_tag="PA14_02870"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0233"
FT   CDS_pept        252660..253601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02870"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15182"
FT                   /db_xref="GOA:A0A0H2ZK29"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK29"
FT                   /protein_id="ABJ15182.1"
FT                   /translation="MSRKLHIHAPAIHYFDMVRRCHSIREAARRLNVASSAVNRQILKL
FT                   EDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLRTGHVEIATI
FT                   EAVTSDLLPCVLKAMRERYPDITVGVTLLGSQAIPEAVSSGAVDLGLAFALPRSADLQQ
FT                   VSVGHFRLGAIVSPQHPLARHQAIAFADCVEHGLIMAKSELSIHHLLAPLQRRLREPRR
FT                   AVLESSSLELSRQLARRGLGVAFQTRLGIEADIAQGELRFLPLKDNGGIHSDLGLYVRT
FT                   GRYLPVAVDALARQIAEEVRLREREEARLNEA"
FT   gene            253792..254625
FT                   /locus_tag="PA14_02890"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0234"
FT   CDS_pept        253792..254625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15183"
FT                   /db_xref="GOA:A0A0H2ZJI0"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJI0"
FT                   /protein_id="ABJ15183.1"
FT                   /translation="MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPD
FT                   KFAKRIYSFTHADGYRYGSNFFNLDVFLSDSRDPRKGTDHGGSEVYAVYRHQLYASRVF
FT                   DRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKN
FT                   HFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNRAAKFQGFVNYVGEKGEDYNDKDTAAE
FT                   TLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF"
FT   gene            complement(254764..256110)
FT                   /gene="pcaK"
FT                   /locus_tag="PA14_02900"
FT   CDS_pept        complement(254764..256110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="PA14_02900"
FT                   /product="4-hydroxybenzoate transporter PcaK"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15184"
FT                   /db_xref="GOA:A0A0H2ZKH2"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH2"
FT                   /protein_id="ABJ15184.1"
FT                   /translation="MNSPSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLDT
FT                   AAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVFLF
FT                   GLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFCGFN
FT                   LGMACGGFVSAKLIPLFGWHSLLLLGGLLPLVLAVVLLFRLPESARYLVVRNRGSERVR
FT                   QVLAPIAPAQVALARSFHVPEQQTVQARNVFAVIFSGTYSAGTLLLWLTYFMGLVIVYL
FT                   LTSWLPTLMRDSGASLEHAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLFYLLAGV
FT                   FAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSWMLGIGRF
FT                   GAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
FT   gene            256416..257195
FT                   /locus_tag="PA14_02910"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0236"
FT   CDS_pept        256416..257195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02910"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15185"
FT                   /db_xref="GOA:A0A0H2ZKF0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF0"
FT                   /protein_id="ABJ15185.1"
FT                   /translation="MAGSLIERALGLLELLASDARGLPLQQLADRLDIPKSAAHRMLAE
FT                   LIRLGYVRQDHDTSRYRLSTRLAALGFRFLASSGVVDLVQPVLDGLARETGELVRLGVI
FT                   EGDRQTWIAKSQGATSGLRYDPDMGREAPLFYTASGHAWLASLSDKAALALVERQGVGA
FT                   ARDFGPNAPRSRSELLRYLKRAREHGYAWQIECSAPGMAAMAALVRHPEDGRALGVLSV
FT                   AGPSARFGEARMHELAPLLLAAAQDLSHASQASELFR"
FT   gene            257439..258482
FT                   /locus_tag="PA14_02930"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0237"
FT   CDS_pept        257439..258482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02930"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15186"
FT                   /db_xref="GOA:A0A0H2ZKP8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP8"
FT                   /protein_id="ABJ15186.1"
FT                   /translation="MDAPLRIALIGAGNMGRQHYHRLQRIAGARLCAVADPQGQAFAAD
FT                   AGVPWFGDHRRLLEEARPQAAIVANPNNLHVATALDCLAAGVPLLLEKPVGVQLDEVSE
FT                   LVAVARRSGVPLLVGHHRRHNPLVVRARQLIAEGALGRLLSVTALWQLKKPDSYFEVAW
FT                   RREPGAGMLLTNLIHDLDLLRHLCGEVREVQALAGNAIRGLPNEDNVALLLRFANGALG
FT                   SLTGCDAAAAPWSWELAAGENPVYPRQAEQPCYLLAGTEGALSLPQLRRWRYAEARQGW
FT                   HDPLAASVEAVAAGDPLQRQLEHFVRVARGEEAPLMDATDAARTLALVEAVREAARSGR
FT                   ACAPASF"
FT   gene            258505..259320
FT                   /locus_tag="PA14_02960"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0238"
FT   CDS_pept        258505..259320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15187"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK34"
FT                   /protein_id="ABJ15187.1"
FT                   /translation="MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEEH
FT                   HYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYVLV
FT                   AGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNAGLL
FT                   LDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPGDGGL
FT                   DLLALLRALPENLPLSLEVPALDLLARGVDGAERARLAIERTRALLARL"
FT   gene            259470..260348
FT                   /locus_tag="PA14_02970"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0239"
FT   CDS_pept        259470..260348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02970"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15188"
FT                   /db_xref="GOA:A0A0H2ZJI7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJI7"
FT                   /protein_id="ABJ15188.1"
FT                   /translation="MNASTSPLPASDQTLRGILLICAAVFLFASHDGLSKFLSGFYPIV
FT                   MVVWARYLVHTLLMVAVFVPRNGLAVIRTRRPLMQLARALCLIGTSLFFTTGLRYLPLA
FT                   EATAVNFLAPLLVTALSVPLLKEKVSLGQWLAVLTGFIGVLFIVRPGGALFTPAALFPL
FT                   GSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLMMIAL
FT                   GGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHVPDAWALLGILVICA
FT                   SGLVVAWRRGR"
FT   gene            complement(260374..261639)
FT                   /locus_tag="PA14_02980"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0240"
FT   CDS_pept        complement(260374..261639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02980"
FT                   /product="putative outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15189"
FT                   /db_xref="GOA:A0A0H2ZKH7"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH7"
FT                   /protein_id="ABJ15189.1"
FT                   /translation="MSHPSHVRALCASLCLGAGLPVHAGHVHAGQGFLEDAKASLTARN
FT                   FHLHRNFVGDASQGKAEEWTQSFILDARSGFTQGSVGFGLDVLGLYSLKLDGGKGTAGT
FT                   QLLPTHDDGRPADDFGRLAVAGKLRVSNSELKIGEWMPVLPILRSDDGRSLPQTFRGGQ
FT                   LSANEIAGLTLYAGQFRGNSPRNDASMQDMSLFGRPTATSDRFDFAGGEYRFNGERSLL
FT                   GLWNAELKDIYRQQYLQLQHSQPLGDWLLGANLGGFRGRDAGSARAGKLDNRTVSALFS
FT                   ARYGLHTLYLGLQKVSGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFVG
FT                   LGLPGLTFMTRYLHGDHVRLAGVTDDGSEWGRESELGYTLQSGAFKRLNVRWRNSSQRR
FT                   DWGSNTRFDENRLIVSYPLSLL"
FT   gene            complement(261705..263030)
FT                   /locus_tag="PA14_02990"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0241"
FT   CDS_pept        complement(261705..263030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02990"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15190"
FT                   /db_xref="GOA:A0A0H2ZKF5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF5"
FT                   /protein_id="ABJ15190.1"
FT                   /translation="MIHSSSSRLLAADAPRESRGGRIRNAFAVGRTRWGMLALVFFATT
FT                   LNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDKVGVKRAFF
FT                   LAVLLWSLATGAHGLATSAAGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGI
FT                   FNAGTNVGAMVTPALLPLILGVWGWQAAFLCMSALGLVWLVFWWRNYYNPEEHPRVKQS
FT                   ELEYIQQQEEPPATRVPFSQILRRRGTWAFALAYSITAPVFWFYLYWLPPFLNQQYGLG
FT                   ISVTQMGIPLILIWLTADFGSVGGGILSSWLIGRGMPAIRARLLSMLLFACTIVGVVFA
FT                   ANASGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPKHLMSTVFGFGGMCAALGGMFMT
FT                   QIVGGVLTATNNNYAVLFTMIPAMYFIALTWLYFMAPRRIEA"
FT   gene            263577..265481
FT                   /locus_tag="PA14_03000"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0242"
FT   CDS_pept        263577..265481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03000"
FT                   /product="putative 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15191"
FT                   /db_xref="GOA:A0A0H2ZKQ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ3"
FT                   /protein_id="ABJ15191.1"
FT                   /translation="MQRSIATVSLSGTLPEKLEAIAATGFDGVEIFENDLLHYDGSPRD
FT                   VRRLCADLGLEILLFQPFRDFEGCRRERLGRNLERAERKFDLMQELGTDLMLVCSNVAA
FT                   DALGEPALLADDLRQLAERAAVRGLRIGYEALAWGRQVNTWEQAWDLVRRADQANLGLI
FT                   LDSFHTLSLDGDPRGIADLPGEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGFDLAG
FT                   FLAPVVASGYRGPLSLEVFNDGFRAAPTRANAVDGLRSLLYLEEKTRERLQRQTPHVAV
FT                   DELFAPPPASLCDGIEFLEFAVDETLGARLGQWLQRLGFARAGEHRSKNVSLLRQGDIN
FT                   LVLNAEPYSFAHGFFEAHGPSLCATALRVRDAGQALGRARAYGGQPYRGLLGPNEREIP
FT                   AVRALDGSLLYLVEQHTEGRSIYDSDFVTNDADTSGLGLRRVDHVALALPAEGLDSWVL
FT                   FYKSLFDFGADDEVVLPDPYGLVTSRAVRSPCGSVRLPLNISEDRNTAIARSLSSYRGS
FT                   GVHHIAFDCADIFAAVAQAKEAGVALLEIPLNYYDDLAARFDFDDEFLSELAYYNVLYD
FT                   RDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVPVRLAAMAQARRGVRRVKL"
FT   gene            265574..266242
FT                   /locus_tag="PA14_03010"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0243"
FT   CDS_pept        265574..266242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03010"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15192"
FT                   /db_xref="GOA:A0A0H2ZK37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK37"
FT                   /protein_id="ABJ15192.1"
FT                   /translation="MSKPDPAVVEESAPRGKGRKNNPEKTRQDILRAAIDEFVAQGLSG
FT                   ARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIEGTLRLGALPPAKAMEK
FT                   LVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNSSIVQSIAEILRRGEAEGV
FT                   FRAGLEALDVHMLISSFCFYRVSNRYTVSRIFRTDLHDAEVRQRHRRMIGEAVLRYIRA
FT                   "
FT   gene            complement(266282..267136)
FT                   /gene="aroE"
FT                   /locus_tag="PA14_03020"
FT   CDS_pept        complement(266282..267136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PA14_03020"
FT                   /product="putative shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15193"
FT                   /db_xref="GOA:A0A0H2ZJJ3"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJJ3"
FT                   /protein_id="ABJ15193.1"
FT                   /translation="MSAPRSVLAGLIGAGIQASRTPALHEREGDAQGIRYLYRLIDLDP
FT                   LGKSADDLEFLLAAASDLGFTGLNVTFPCKQAIIPLLDELSAEARGIGAVNTVVLRDGR
FT                   RIGHNTDCLGFAEGFRRGLADAPRQRVVQMGAGGAGAAVAHALLAEGVERLVLFDVDPA
FT                   RAQALADNLNQHFGAPRALAGSDLAGALGDAQGLVNTTPVGMAKLPGMPVPAELLRADL
FT                   WVAEVIYFPLETELLRQARALGCRTLDGGTMAVFQAVKAFELFSGVEADAARMQAHFAS
FT                   LGD"
FT   gene            complement(267133..267579)
FT                   /gene="aroQ2"
FT                   /locus_tag="PA14_03030"
FT   CDS_pept        complement(267133..267579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ2"
FT                   /locus_tag="PA14_03030"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15194"
FT                   /db_xref="GOA:A0A0H2ZKI2"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI2"
FT                   /protein_id="ABJ15194.1"
FT                   /translation="MTRTVLVLNGPNLNLLGIREPQTYGRRTLGEIADECAAFAETRGF
FT                   AVDFRQTNQEGQLLDWIHQARGRVAGIVINPAAWTHTSVALRDALAAVELPVVEVHLSN
FT                   VHQREAFRHHSYVSPVALGVICGFGSLGYRLALEHFAERFEAAA"
FT   gene            complement(267696..269201)
FT                   /locus_tag="PA14_03040"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0246"
FT   CDS_pept        complement(267696..269201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03040"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15195"
FT                   /db_xref="GOA:A0A0H2ZKG1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG1"
FT                   /protein_id="ABJ15195.1"
FT                   /translation="MSDLAQNPPAVRTVLAGLMLSIFLSALDQTIVAVSLPAISADFAD
FT                   LDLLAWVISAYMVAMTVSMPIYGKLGDLYGRRRLMLFAIVVFTAASLLCGLAQSMGQLV
FT                   LARVLQGVGAGGLMAVSQAIIGDIVPPRERGRYQGYFSSMYAIASVAGPVLGGLLTEYL
FT                   SWRWVFWINLPIGLLALAISRRTLVGLPVPRRQPVIDYLGIVLMVVGLTALLLAITQIG
FT                   QGAAWSDPALLGLFALAALALLLFVAQERRFREPLVPMQLFAVRAATLSWLVAFFASFQ
FT                   AISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAYCCGRLTASLGRYKPLILLGA
FT                   VLLPCGIAGLALVPVGDHWLSGLCMLLTGIAIGTQFPTSLVAAQNAVEQRHIGVATSNA
FT                   TLFRSLGGAVGVALMSAILLALLKHLRIGGGLDQGFSESALLSSLDAASGPARVILQHV
FT                   LADAFKVLFLVNAAVALLGLAVASALPDMTLRGRGATQPTAGE"
FT   gene            complement(269376..270560)
FT                   /gene="pobA"
FT                   /locus_tag="PA14_03050"
FT   CDS_pept        complement(269376..270560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="PA14_03050"
FT                   /product="p-hydroxybenzoate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15196"
FT                   /db_xref="GOA:A0A0H2ZKQ9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ9"
FT                   /protein_id="ABJ15196.1"
FT                   /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRA
FT                   GVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRINLKRLSGGKTVTVYGQTE
FT                   VTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHG
FT                   ISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYY
FT                   VQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRL
FT                   FLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAE
FT                   RFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE"
FT   gene            270738..271604
FT                   /gene="pobR"
FT                   /locus_tag="PA14_03070"
FT   CDS_pept        270738..271604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobR"
FT                   /locus_tag="PA14_03070"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15197"
FT                   /db_xref="GOA:A0A0H2ZK41"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK41"
FT                   /protein_id="ABJ15197.1"
FT                   /translation="MTDSTRDVPVFKLYGAPLEWPTPDLLHCESIPARSRLHDWEIKPH
FT                   RHADLAQLLYVRKGWAQLQVEGEPTRVEQPSIQFVPPLCIHGFQFSERIDGYVLTLAAP
FT                   LLARLQAHLGAQRQALEAPGLYPVGAYRRYIDTLFDAIDGEYAGAAPARELLLQSLIGV
FT                   LAVWLGRQVMVRRAEARPGRGQEYLSAFSQLVERHFREHLGIDEYARRLGISPAHLNSV
FT                   ARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRLSGVSP
FT                   SVFRKGD"
FT   gene            complement(271601..272047)
FT                   /locus_tag="PA14_03080"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0249"
FT   CDS_pept        complement(271601..272047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03080"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15198"
FT                   /db_xref="GOA:A0A0H2ZJJ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJJ8"
FT                   /protein_id="ABJ15198.1"
FT                   /translation="MSSPPKIRRYIPADRDATLAIWLEASRVGHGFLGEAELQKQKALV
FT                   RDHYLDASETWLALDGDTPLGFIGLLDAFIGGLFVAPTAHGRGIGRQLVEHAATLKGAL
FT                   EVEVYAANREALGFYARCGFVESGRRPRDDEGRALEIVQLRREH"
FT   gene            complement(272125..272559)
FT                   /locus_tag="PA14_03090"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0250"
FT   CDS_pept        complement(272125..272559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03090"
FT                   /product="putative CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15199"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI6"
FT                   /protein_id="ABJ15199.1"
FT                   /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVVNH
FT                   GEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHLRH
FT                   LPVVEDGQLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
FT   gene            complement(272724..273365)
FT                   /locus_tag="PA14_03100"
FT   CDS_pept        complement(272724..273365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15200"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR037181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG4"
FT                   /protein_id="ABJ15200.1"
FT                   /translation="MNDYIARLREKYDDHFGCAPSIVLDCRDFWRHCVTAPEMAVFGYR
FT                   LESSRRPHHVVITAGMSQARMHFAPYMGSARWSSELICYLDVLGGEDLRHLQWLAGLPF
FT                   HERLALGHGHSVAFGFPLYEHSLLRHFLLLPTPLGEDAALFDGFDLSAHPVDLLWVVPL
FT                   TEQEYQVKVNKHLEGIAEVLNDAGHPLSLDRHRHCYVTGLRPEGFERILH"
FT   gene            complement(273633..273920)
FT                   /locus_tag="PA14_03110"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0252"
FT   CDS_pept        complement(273633..273920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU1"
FT                   /protein_id="ABJ15201.1"
FT                   /translation="MGGLRKPIRPAMPRHPHTTLLLCLCLTLPGCESGRSYSFSEDAPV
FT                   TGIRIQRDDRSPLQRLRDCERQGCSERQKIDPFTPDPDYLRAEGHFPLPW"
FT   gene            complement(274012..274488)
FT                   /locus_tag="PA14_03120"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0253"
FT   CDS_pept        complement(274012..274488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03120"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15202"
FT                   /db_xref="GOA:A0A0H2ZK63"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK63"
FT                   /protein_id="ABJ15202.1"
FT                   /translation="MTGPMTETNALGLPQGPLYLMTEIVRQRERQLTALLAPLELGLHE
FT                   WRALRIIHAFDGDVPMSVLIEHSQTDRTALGRTIERLVRRGWVSRLPDPDDGRAVLVRR
FT                   SPAAQAVFEQALAQVAGLDERLLAALGAGPEEEALTLALGKLLRAFDGLSRVTQ"
FT   gene            complement(274529..276019)
FT                   /locus_tag="PA14_03130"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0254"
FT   CDS_pept        complement(274529..276019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03130"
FT                   /product="putative 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15203"
FT                   /db_xref="GOA:A0A0H2ZJP0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032903"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP0"
FT                   /protein_id="ABJ15203.1"
FT                   /translation="MNRSALDFRHFIDHLRRQGDLVDVHTEVDANLEIGAITRRVYERR
FT                   APAPLFHNIRDSLPGARVLGAPAGLRADRARAHSRLALHFGLPEHSGPRDIVATLRAAM
FT                   RAEPIAPRRLERGPVQENVWLGEQVDLTRFPVPLLHEQDGGRYFGTYGFHVVQTPDGSW
FT                   DSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRQGKPTPWAMALGAPPAALAAAGMP
FT                   LPEGVSEAGYVGALVGEPVEVVRTQTNGLWVPANAEIVLEGEISLDETALEGPMGEYHG
FT                   YSFPTGKPQPLFHVHALSFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVAQNAGLP
FT                   VDMAWCSYEAATCWAVLSIDVQRLAALGTDAAAFAARVAETVFGSHAGHLVPKLILVGN
FT                   DIDVTEIDQVVWALATRAHPLHDHFAFPQIRDFPMVPYLDAEDKARGSGGRLVINCLYP
FT                   EQFAGQMRAATASFRHAYPTALRRRVEERWSDYGFADA"
FT   gene            complement(276153..276839)
FT                   /locus_tag="PA14_03150"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0255"
FT   CDS_pept        complement(276153..276839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03150"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15204"
FT                   /db_xref="GOA:A0A0H2ZKM7"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM7"
FT                   /protein_id="ABJ15204.1"
FT                   /translation="MVGSSARRLRLRRTRGRVGLGLVAGLSVLAGMTDAIGFLATGDFV
FT                   SFMSGNTTRLAVSLGEGDFGGLVRLSVALASFVVGNALGVILARFSGRRAAPILVCCAM
FT                   LLALSAVWPFDWNVPALVAAILAMGMLNAVVEQVNGLPIGLTYVTGALSRFGRGLGRWL
FT                   LGERRNGWRVQLVPWSGMCVGAVLGALLEQQLGLAAMAASAALAALLALLALVIPRPWQ
FT                   MDYMVR"
FT   gene            complement(277003..277935)
FT                   /locus_tag="PA14_03160"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0256"
FT   CDS_pept        complement(277003..277935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ0"
FT                   /protein_id="ABJ15205.1"
FT                   /translation="MRSWHGVVTKIAKQGKGAVVKNRLGPEELLVPFTVSTLVEVDLDA
FT                   RIYGTDVDDTPWAEGDERKEVLVGTEVELLTDTDTFPTHASQVLSANFRFALDIVKGGL
FT                   SGPVRKGAVLVIYHDFQQEIRRGDSGSAFAEAVVAYARNKLYKPAFAIKADTNYAQLVR
FT                   DLGKVAAESGEQYFIDTILIATHGTAGQLWLGNPHGDSTADVMARRVQGKQFVEPQAFG
FT                   ATLLELFGKELAIALYGCDFAGDEDGEAAALELRIAANARAVYAGKGTVYLNASKEGRS
FT                   TVTCSKAMVVYRTDKIEVLGGNQVPVFDI"
FT   gene            278510..279133
FT                   /locus_tag="PA14_03163"
FT   CDS_pept        278510..279133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03163"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15668"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ8"
FT                   /protein_id="ABJ15668.1"
FT                   /translation="MSSPIIRHHLLHRLRDRQERFDVIFSEQKVAHMAAFFLASAEGPL
FT                   PHLTLIKLLYLADRESMARFDVPMSDDRAVSMPHGPVLSSTLDLIKGRLRSEVWSAWIS
FT                   PLVDHEVRLVHDVENWDDLDELSRSDRSILESVWQEFGHMTKYQLRDYTHHHIGEWHDP
FT                   HGSSRDIDPKDTFMALGQSEELAEIKARDLAERRRHGRKLSEFI"
FT   gene            279133..279531
FT                   /locus_tag="PA14_03166"
FT   CDS_pept        279133..279531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03166"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLW4"
FT                   /protein_id="ABJ15667.1"
FT                   /translation="MPGNVFQKGTLLIPTGGANHLHFVMNDPVYCPVLGYDAVLLVNIS
FT                   TVYPDKYFDQSCILKKGCHPFVLRDSWVVYREAGPFNLARLEQGVAQKSIKTHQPINAG
FT                   DFTRIRAGFDISPDVKIKVERFMRQHKI"
FT   gene            complement(279718..280557)
FT                   /locus_tag="PA14_03170"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0987"
FT   CDS_pept        complement(279718..280557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15206"
FT                   /db_xref="GOA:A0A0H2ZKU6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU6"
FT                   /protein_id="ABJ15206.1"
FT                   /translation="MQARTGISERRACQLIGLSRSVLRYQPRASVQNELQAQLVELAQE
FT                   RRRFGYRRLHILLRRAGVQVNHKRIYRLYRAAGLMVKRRRRRHGVAVERERLSLPSAPN
FT                   QVWSMDFVFDALSTGRRIKCLTVVDDFTKESVGILVEHGISGFRVTRALDEMARFRGYP
FT                   KASRTDQGPEFTGKALDQWAYQRDIKLKLIQPGKPTQNAFIKSFNGKFRDECLSEHWFY
FT                   SLAEARIRIAAWRRDYNEHRPHSAIGNLTPAEFAASWRTRQQQLKQEKLISTPGLTN"
FT   gene            complement(280590..280853)
FT                   /locus_tag="PA14_03180"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0986"
FT   CDS_pept        complement(280590..280853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15207"
FT                   /db_xref="GOA:A0A0H2ZK68"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK68"
FT                   /protein_id="ABJ15207.1"
FT                   /translation="MKKRFTEEQTLDFLKQAEAGVPVKELCRRHGFSDASFYTWRAKFG
FT                   GMTVADAKRLKDLELENSRLKKLLAEAHLDIESLKVVARGKG"
FT   gene            complement(280973..282415)
FT                   /locus_tag="PA14_03190"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0259"
FT   CDS_pept        complement(280973..282415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15208"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP5"
FT                   /protein_id="ABJ15208.1"
FT                   /translation="MSADAYHAPKTSPRLETLDVLSIGMSLDVFRQGQVWKALQEQNAV
FT                   QAEALHVGSILPMDPKKYPTSADDKDMAYEKRQADALELGLKNFLEKWPIPTVTVVRSW
FT                   DPSTPNLRFTPEETRESLSVKVNDLRVPAGLHWHRIANLQDGIICNDTPEGVLEALFSL
FT                   FERNPDLPAVLVYANEGFNMAGSLSSRDVPLKSLGGGSGPRVPGTLTDTMVALIVGRPE
FT                   RVDWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPVL
FT                   ARLHRPVSVPLTRPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLA
FT                   ELTPALGAAQSSLDLLDSRESYDLTQRLGDTGAASPFVGIALATMASYLNGDSSMVMPL
FT                   RRKDQATLIGISSPTPGKKPAHDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPG
FT                   EDYALEEFLSSLKPSTDWQDDL"
FT   gene            complement(282565..284715)
FT                   /locus_tag="PA14_03200"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   PA0260"
FT   CDS_pept        complement(282565..284715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15209"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN3"
FT                   /protein_id="ABJ15209.1"
FT                   /translation="MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDL
FT                   AGCYERIERGLCQGLNERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDAVYYR
FT                   RKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFV
FT                   NATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIR
FT                   KRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWS
FT                   SQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGLGCQTTID
FT                   GERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQR
FT                   IFTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTA
FT                   PRLPLPTEARFDFDGTVTAPGENSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVA
FT                   QQVDTALAYRYGRDTRSVERALNEGKELARQTHVFSARELGTGMVLVTRAETPYEARLR
FT                   LQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDW
FT                   KAKDKGLNGQANDEIHIPSEEVQALYHAEEPKNSELIDATVVYRKSGKLPVTVGDSLPS
FT                   LVATQTIEDRYYSRPVRFGGAS"
FT   gene            complement(284712..285209)
FT                   /locus_tag="PA14_03210"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0261"
FT   CDS_pept        complement(284712..285209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ3"
FT                   /protein_id="ABJ15210.1"
FT                   /translation="MKCKTLLIACLFGLGSVQALAVSKLPPQIPVHAGSGRVTLDLRPL
FT                   LAETNDVEITRVSVCRRVGSHCQETLWRIELPPGWRAGEIEVFGDYPGSSVLLRRPERL
FT                   QPDGSYNAFIHFNERSRRHRQTVSSIAVEFCLAGEPGNWMLLDEATCLARRNAEERQGE
FT                   KP"
FT   gene            complement(285213..288272)
FT                   /locus_tag="PA14_03220"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0262"
FT   CDS_pept        complement(285213..288272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15211"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV2"
FT                   /protein_id="ABJ15211.1"
FT                   /translation="MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKN
FT                   AIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELC
FT                   CNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEE
FT                   GLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTA
FT                   RQTQRDYSFKRPTYDQEHHLAGEALEHQDSSYERYDYPGRYKQSGAGRPFSESRLRGHR
FT                   RDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPL
FT                   GVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDR
FT                   EGRHDEFSTCWIRVAQNWAGADWGNMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNR
FT                   PPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRP
FT                   EGGKPRGEGFELRTDEHGAVRAARGLLLSTEEQLRAGAGHLDRGVVVQVLEAALELARE
FT                   LGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATP
FT                   TSLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQK
FT                   NDIRLEAEQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKH
FT                   SHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGA
FT                   TQLLQKDAMNIAKVDMKHTRSPASAVAGIAAAVGAAVAVGKLLSGPDAEAGRALSEGEI
FT                   SLAKDVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQ
FT                   GLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIV
FT                   RDYFLEKNEFGEASANSRFAGVLKNFPTGY"
FT   gene            complement(288454..288972)
FT                   /gene="hcpC"
FT                   /locus_tag="PA14_03240"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0263"
FT   CDS_pept        complement(288454..288972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpC"
FT                   /locus_tag="PA14_03240"
FT                   /product="Secreted protein Hcp"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15212"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Z8M3"
FT                   /protein_id="ABJ15212.1"
FT                   /translation="MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFN
FT                   HEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAA
FT                   GTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGS
FT                   DDWRSPVAG"
FT   gene            291568..293184
FT                   /locus_tag="PA14_03250"
FT   CDS_pept        291568..293184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15213"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP9"
FT                   /protein_id="ABJ15213.1"
FT                   /translation="MAQAIPAIEQAHPPGQIRIMRPRLTSVVSCWDYLWKVAAMEESAQ
FT                   QRSERYVSARSQHPAWLLLASRRAPLVLGCLRTLFERAHDGIPMEDALQALSEMLAAYA
FT                   SQELYEIDPDATHLQAGRELREWIKRRLVVEREGRIYATDALESAIQFVDSLDSRIMTS
FT                   TASRLSVVQREIENLETGLNPSPTGRIASLRRRIQDLEHELARVEAGHVDVLDEAQAIE
FT                   GMREVYNLATSLRADFRRVEDSWREADRALRHSIISEQSHRGEIVDRLLDGQDALLNTP
FT                   EGRVFESFQQQLRQSAELEVMRERLRTILRHPAVPKALNRPQQRELRWLALRLVRESQA
FT                   VLQARARSERDVRGFMKTGLAAEHHRVGQLLNDFFNLALSVDWQRQSERRKPACLPPVG
FT                   VAITGVPAIERLRFKTLDDDDAGELDLSLKPAGLEQIDDDFWDAFDGLDREALIHDTLA
FT                   VLVEQGRPVSLGELASLLPPAHDLETFALWLAMAREAGIEVLTEERQFVELVDEDEQRW
FT                   GFNLPYVGLDHEALKDIDWEL"
FT   gene            293187..293936
FT                   /locus_tag="PA14_03265"
FT   CDS_pept        293187..293936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15670"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL66"
FT                   /protein_id="ABJ15670.1"
FT                   /translation="MAGIFDRIAGASGADETELTAEPMALDDGMDGEQPAMSANIQVDE
FT                   RRTPQRVREAVQEMLKYGLLEESHKPNLYRSALTNIEVVDRILEPLDLAMGVDEVRGLV
FT                   FVTVRQGEVAEQDDWSHPLVRRQRLNLEQSLLIAILRQHFIAYEQESGTGASQALVAVD
FT                   ELIPQLQVYLGELGSEAKERNRIITLLDQLKGHGLVSALDAHDRVIIRPIITHLANPEN
FT                   LQALVVWLREQVEGAVTPAAGGEEDEA"
FT   gene            294101..297238
FT                   /locus_tag="PA14_03270"
FT   CDS_pept        294101..297238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN9"
FT                   /protein_id="ABJ15214.1"
FT                   /translation="MTLLCANPRYNLASTGGHESDRDLVSYVRGVTGPGDGGVEQSHIA
FT                   RQGKTVTAIAATLERDGAQVRLGAVLWFEGTSSSASDLKKLWLLSESPEQTLEHWLSQH
FT                   HAGGMRALRQMEKDGMGIWPYPSKKAFLARLRDYFEVGENAFTLLNRAAGLKQLNSIDE
FT                   IFRELVLDDRSAFERAAEVASSFDDLTDIHRELETARKQQRSLQPVADGWERYRALQEQ
FT                   LQDKQALEGILPVWFAEQGYRLWLAETNRLEKEHKQAELDQAQCRSQLEIQKGVVDQHR
FT                   QRYLRVGGAGIDQLRGRIADWVRECDKRRLKAEQYQRLAKGLGLADELSAAALEENQQQ
FT                   IAARLEILAQQTTDARQKAFDAGLVQQELNGRLQSLQQERAEVERRPGSNLPGHFHAFR
FT                   GDLAQELGVDESALPFVAELVQVKPEELAWRGAIERAIGSHRLRILVPQGSSQAALRWV
FT                   NQRHNRLHVRLLEVKEPSSRPVFFDDGFTRKLTFKEHPYREAVKALLADNDRHCVESTE
FT                   QLRHTPHAMTAQGLMSGKERFFDKQDQKRLDEDWLTGFDNRDRLAFLAEQIREVNEQLV
FT                   PAKLALDAAQGDVGQLESQASLLQRIEELQFDDIDRPGAERQLQSLRTQLDTLTRPDSN
FT                   LAVIKAELDQAEALRESLDQQLQRLIEQCVQLKTQFDQAASATRKAYRGAEKGLSDTQR
FT                   ELAQAHFPILSTDDLGDIDELERKHTRELQGQLKTLGEKLGDQKTELAKRMSDALKADT
FT                   GALAEVGRELVDVPRYLERLRVLTEEALPEKLKRFLEYLNRSSDDGVTQLLSYIDHEVS
FT                   MIEERLDDLNSTMQRVDFQPGRYLRLVAKKVIHESLRTLQHAQRQLNSARFIDDEGESH
FT                   YKALQALVGLLKDACEHSRNQGAKALLDPRFRLEFAVSVIDREGNNLIETRTGSQGGSG
FT                   GEKEIIASYVLTASLSYALCPDGSSRPLFGTIVLDEAFSRSSHAVAGRIIAALREFGLH
FT                   AVFITPNKEMRLLRHHTRSAVVVHRRGVESSLVSLSWEALDEHHQQRIRAMHEVAH"
FT   gene            297222..298367
FT                   /locus_tag="PA14_03285"
FT   CDS_pept        297222..298367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15669"
FT                   /db_xref="InterPro:IPR014544"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZM47"
FT                   /protein_id="ABJ15669.1"
FT                   /translation="MKSPTDIGRNLARQWQRSSVRLERLLNPGSWPQSLNIGKPSARLF
FT                   TDNIQAVLRHVENWRSVNVGKVDWEPVSYRAGLAPISLPMRWHLRSPSEWIAASDDPRV
FT                   SQEYAQLEYLVEQVDSAFHTLLVAQRSLWLTRTPEEVVATAQLATQLAPGCAQGRPLRL
FT                   LAEHGVDTKFFERNATLLTKLLDERFEGAASEQGLTTFLDAFEESSHWVLVVPLQPGLL
FT                   PFKRLRLTTSELAETPLPGSRLLVVENEQCVHLLPETLPDTLAVLGAGLDLHWLASAHL
FT                   AGKQIGYWGDMDTWGLLMLARARLHQPAVEALLMEQELFEQHSQGNTVVEPAKALESAP
FT                   PGLLADEADFYRYLLVQERGRLEQEYLPKAQVELAIRKWAR"
FT   gene            298567..298875
FT                   /locus_tag="PA14_03290"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA1937"
FT   CDS_pept        298567..298875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15215"
FT                   /db_xref="GOA:A0A0H2Z7I3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Z7I3"
FT                   /protein_id="ABJ15215.1"
FT                   /translation="MSKQRRTFSAEFKREAAALVLDQGYSHIDACRSLGVVDSALRRWV
FT                   KQLEAERQGVTPKSKALTPEQQKIQELEARINRLEREKAILKKATALLMSDELDRTR"
FT   gene            298872..299717
FT                   /locus_tag="PA14_03300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA1938"
FT   CDS_pept        298872..299717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15216"
FT                   /db_xref="GOA:A0A0H2ZKV6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV6"
FT                   /protein_id="ABJ15216.1"
FT                   /translation="MIDQLSEQESVEVVCSAFDVARSCYYVHRLRRRRVDARRVALRSQ
FT                   VNQLFSQSRGSAGSRSILGMLREEGVTIGRFRVRRLMRELGLVSKQPGSHAYKQATVER
FT                   PDIPNRLNREFATEHPNQVWCGDITYVWAQGRWHYLAAVLDLLIGWAFSAKPDAELVIK
FT                   ALDMAYEQRGRPQQVLFHSVQGSQYASRLFRQRLWRYRMQQSMSRRGNCWDNSPMERLF
FT                   RSLKSEWVPSTGYLTAQEAQRDISHYLMHRYNWIRPHQFNDGLPPAVAEEKLNPLSGMG
FT                   "
FT   gene            300333..301931
FT                   /locus_tag="PA14_03310"
FT   CDS_pept        300333..301931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15217"
FT                   /db_xref="GOA:A0A0H2ZK75"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK75"
FT                   /protein_id="ABJ15217.1"
FT                   /translation="MACSHKKPGFLVPALIETEHLSNMSFLRDFRRVVARAAFRLLADR
FT                   LPKPRSTKESLHILVPRWDAKLGDSIVSSFFFREARRLNARVTVLTVVELAQAHTQDFG
FT                   VDQVVITNANPGVLELRRLAQQLGQVDVVVHLVGRIQPAEILFLRLLRPTRVYSLDDRL
FT                   RCVNRKFGETTAGLDMAERYRRVLMDLGASMVDRKYIVPLPDTMPNPTLAPKILLNPYA
FT                   SRPDKCLAFDRSVSLLHAIADAYPTRSVGILCSPATQEDALRMEVAVARSNVHVVHGLA
FT                   SPKDVAGYIRCAQVVVSVDTAIVHMAVGLETRLVAIYPDVDGQANPWLPPPSPLTRVVY
FT                   SQQHPGQIRRTGKKDMNAFSLEALLDNLHELLATTPETEQLHSIRARKVPGLGAANGTL
FT                   ARQLPLISQDFPEVADCHPGTINLELECPLEVTQPDHRTAPLAWTPSGRTTEVFDLVRI
FT                   ELEFGPLPTRVPAWLYVAHGSPHRCTPTVHEVIARQLNLSEVRECQVHLRASAVTLARP
FT                   DQQTASISRSLSPSQ"
FT   gene            complement(302683..303804)
FT                   /locus_tag="PA14_03320"
FT   CDS_pept        complement(302683..303804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15218"
FT                   /db_xref="InterPro:IPR028944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ3"
FT                   /protein_id="ABJ15218.1"
FT                   /translation="MTPGKSLPWSEVLTRPVDVQLTMFRQASAQPCADDVKTGFRAFSA
FT                   DLFARGLISMAEYVSIFGGTVLHCLTPAESGLFRDMDTGADASALAGVYSRAKYGSVGD
FT                   IQYLARQLIDYLCGELDRPDSQWSCLFRNAKACGDNVVMMTTGWRNVPSTANVLYEIVV
FT                   EEVNVKLAHMALPTIINVKLPRIAPPCEDYANLSTEERERVNLVQDHVIPAENFYRWSG
FT                   VHVIFGDDVLVTGSTADKVLYESMRSGAKSFRAIYPVAIDPRVALGDASVEDRLNSVVV
FT                   EQRLDDTVAELLSARDYQPILRTLRLLFGEGNRESLAAFLPKVPAPTWLRLYKSALGNE
FT                   FLGQPQCAPSLVLLREYLTNAGLLSTNGRAIHP"
FT   gene            complement(303810..304676)
FT                   /locus_tag="PA14_03330"
FT   CDS_pept        complement(303810..304676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15219"
FT                   /db_xref="GOA:A0A0H2ZKP4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP4"
FT                   /protein_id="ABJ15219.1"
FT                   /translation="MIDSHSHTFYSKHATGTVDELVRASIAAGVTILTLTDHAPFPVDT
FT                   DNRLLASELDRYFADIERARNSYQEQITILCGLELDYMPGTDAFNRELLTCYPMDFVIG
FT                   SIHYVEVPDETMVKVWELPRLAGQAFLDRYFANLEGLLDSGLFDAVGHADTLLRGVPED
FT                   IFLRRFEPLLAPLARSGIAFELNASGLRKSSLDPATGREVQGFWSYPSRELVAQLIAHE
FT                   VPFTVGSDTHDPSDAGAGIAELLTALQPLGLQRISYYERRRRIDVALDTLALPGAPATL
FT                   TEGLERP"
FT   gene            complement(304673..305599)
FT                   /locus_tag="PA14_03340"
FT   CDS_pept        complement(304673..305599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK0"
FT                   /protein_id="ABJ15220.1"
FT                   /translation="MELSTLARENLARLINAPEVKRISISGEGEPLNNVKVFHEILGLS
FT                   EGGKCFEFITSGFYPHDKMADFYDTTNRIVLGNGDVCNIRLSADSHHIEQVKWRAHGFS
FT                   LDYLRSRCPSGLSFSFRSIDTDRDFTREYLKSELARWGVEATIEPRSVLEDVLVAGGEC
FT                   FGIDYKNLVHPAPGTAPGYLDMLGYIEAIESKVNKRFTFGSLNKPPQANGLDVTVKPNG
FT                   DVYLYGIENQRLGNIHFDRVDWQRLVAHVRETPLTRALYTQPLTELLARLEKTDLLRSI
FT                   IAKANNPYWLVKELAGHAGLLEQWEAA"
FT   gene            complement(305950..306903)
FT                   /locus_tag="PA14_03350"
FT   CDS_pept        complement(305950..306903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW0"
FT                   /protein_id="ABJ15221.1"
FT                   /translation="MAELNVIFDVPEAIAEGLKNGVYERIGGVIRRVADKQIVMWLQEG
FT                   VLLERDTAEQLLKQGAEHVQLLRQQAEQLQMLGVQQQLIMGLEVANLAVSVAGFALTLY
FT                   KLQGIENQLRHMDGKLDDIRQGVEWLDVRQMISRLAPLHAALQHVREAGLYRNAAMMQQ
FT                   QLGIANSQLAESQSYFGGLLQHVSERSFEYLQPGEFAAAYRGWVMSAQGRLQVLARLGE
FT                   MDLAAHLANEFKERHAGFGQRLQQSLKNPALRLMAGQQGETNHARLLSIAEQAVGAHEI
FT                   IRGNVMQLEFMRDEQLDLPILNSPAGYQGLAFCRVG"
FT   gene            complement(306896..307666)
FT                   /locus_tag="PA14_03360"
FT   CDS_pept        complement(306896..307666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15222"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK79"
FT                   /protein_id="ABJ15222.1"
FT                   /translation="MTSIDISNTRQLLERASNDDLEPLVEYILKANTESLSKQVDFKRS
FT                   HPEHRRYASSILDELRLFGGNSFVNLWRKSGPSYTEVVRDVASKLKVKGAGSMELIELE
FT                   EAMVQSILRQALEKSSGEDRRELEVILREAGLDKTKMTALLNGSALSGLVVPTVARLIL
FT                   YRTSTVIVNSMAQQLLGHGLRSAVVAGGTFAGGRAVAALAGPVGWVIAGIWTAVDLAGP
FT                   AYRVTIPCVLQIAMLRLKARAEAATDFMNGAFDG"
FT   gene            complement(307985..308983)
FT                   /locus_tag="PA14_03370"
FT   CDS_pept        complement(307985..308983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15223"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ8"
FT                   /protein_id="ABJ15223.1"
FT                   /translation="MAPPRLPQAQCLDAPPSPCRPASRCAGRSSWCASEPGHSTRPEHR
FT                   RLVHRTFKRNRSMSIIHDADLAGVLMSASADDIRLLIDVITDSGKGRISLSSAICRQLT
FT                   AAKEGEVGDYERALVAEELTRFGGNSLMNLFRGGSGVSYVELLSDVASHVGVSKAGTGD
FT                   CAQMEMAIIAKVVEQSIGRMSEEDKETFFESMGASYRPGMGAAALAALITSLSASSTAY
FT                   RLAAVVASATMSSLVGRGVAFAGGAAMGRGLAVLSGPVGWAITGIWTAFELASPAYRVT
FT                   VPCVIQIGHMRQKMLLKEGCPECHASTPAGSKFCSSCGARLASRLPHSIHD"
FT   gene            309749..311728
FT                   /locus_tag="PA14_03380"
FT   CDS_pept        309749..311728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15224"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP9"
FT                   /protein_id="ABJ15224.1"
FT                   /translation="MRLKKRHDPMIALEAAQSFTKRELCVPLARWISDFLSRRGLQKPD
FT                   GRPLFAYKTSSEEFRALRQLLQNLPGGQQVSPSYPQAWLLFAAEWWKREYSGGAWRWGP
FT                   LCEAAGQRGLSHEKTRKLVIEGRRQWCLQTAIKNEGKRFIGLVAVNGGLPMRLVESAQG
FT                   GLSGLLRMVTLQAVDYDLHDEQLRQAIEAQAALLPACYQQAPVYELLDNLIKAVLHIRR
FT                   TYALKGTQDPIAKLQEECPQWEELFPIALDSQAAASLIKGLVRVTVSITPQSRRPPFQI
FT                   QRGLRFSSDGSMPVYELSFAMQAQAKRDQVAESLGLAADRLPPHFQLLLRIGEREHLVG
FT                   EALLRDDEYQLIARPLPSIQTVHEAAQLIVSRWGATLHIANLPGGEALSHDEPLIFENT
FT                   YPFARLIAQGDALVKGLSALAVMPARTIVLAEEGETRELHDCLADGQMLMELPAGKTRL
FT                   AYRGQAFIVTISASATHRPEAYWQGNSLEALSVPGLLFRGTPHLRVDQGLGHSSYAPSH
FT                   ELFVRSHSKELPLGEAQAPGLCRLIWRKDGQRLLSTRAVLLPEGASITYVPAASTLEGT
FT                   IRLDNWPDVPVRCENEEIELDSRHDGTNLVLRLKSTSARPATSVPLCMQWPDGEHRLTL
FT                   PFPGYGVTLQRNNLMWLIRVAVRL"
FT   gene            complement(311665..312174)
FT                   /locus_tag="PA14_03390"
FT   CDS_pept        complement(311665..312174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15225"
FT                   /db_xref="GOA:A0A0H2ZKK3"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK3"
FT                   /protein_id="ABJ15225.1"
FT                   /translation="MGKIVARKETGNLFFDFRYLGKRCREQTALPDTPTNRKKLEKILE
FT                   RIEAEITLGTFDYNEYFPQSGRADELSRLKAGISRLKVPQFKDFAQLWFDEKKMEWRDS
FT                   HTNTVRLTLEKYLLPTFGKQEVSAITKADILAFRSALGKVPGQKGQSLTATRINHIRLL
FT                   RCSVTP"
FT   gene            complement(312167..312499)
FT                   /locus_tag="PA14_03400"
FT   CDS_pept        complement(312167..312499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW6"
FT                   /protein_id="ABJ15226.1"
FT                   /translation="MSQKQLESLIRLINITFDPNSSYLIHLNPERVMNEIYLTTDELSQ
FT                   RIKYDARTIRNCLKDSVLLEGIHYFRPFGGRKILFIWEAVERDMVKFSRENGFGIPMAN
FT                   GGICRG"
FT   gene            complement(312961..313034)
FT                   /locus_tag="PA14_03410"
FT   tRNA            complement(312961..313034)
FT                   /locus_tag="PA14_03410"
FT                   /product="tRNA-Arg"
FT   gene            complement(313222..313638)
FT                   /locus_tag="PA14_03420"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0264"
FT   CDS_pept        complement(313222..313638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK82"
FT                   /protein_id="ABJ15227.1"
FT                   /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIRKGQRPGVPFPAPCASG
FT                   VAVTGRPPCATGGRGRTRPPTGVGEDTKDSCGKGIADETPRRHHGGPAARKAGRATGRS
FT                   ERGHSRGTRPAELMPIPRSPVVVALGAFEISNES"
FT   gene            313663..315114
FT                   /gene="gabD"
FT                   /locus_tag="PA14_03430"
FT   CDS_pept        313663..315114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="PA14_03430"
FT                   /product="succinate-semialdehyde dehydrogenase,
FT                   NADP-dependent activity"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15228"
FT                   /db_xref="GOA:A0A0H2ZJR3"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR3"
FT                   /protein_id="ABJ15228.1"
FT                   /translation="MQLKDAKLFRQQAYVDGAWVDADNGQTIKVNNPATGEIIGSVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPLAE
FT                   AKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPSAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGGELTS
FT                   NPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEGALISK
FT                   YRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVTKV
FT                   EEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKNALVSKDETFGPLAPVFRFKD
FT                   EAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKAS
FT                   GLGREGSKYGIEDYLEIKYLCLGGI"
FT   gene            315359..316639
FT                   /gene="gabT"
FT                   /locus_tag="PA14_03450"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0266"
FT   CDS_pept        315359..316639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="PA14_03450"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15229"
FT                   /db_xref="GOA:A0A0H2ZKQ4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ4"
FT                   /protein_id="ABJ15229.1"
FT                   /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYI
FT                   DFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPK
FT                   KTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSF
FT                   MQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVA
FT                   GKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQALGERLKAGLREIQ
FT                   AKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIR
FT                   FLMPVTIPDAQLEKGLAILAECFDELA"
FT   gene            316965..318164
FT                   /locus_tag="PA14_03470"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0267"
FT   CDS_pept        316965..318164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03470"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15230"
FT                   /db_xref="GOA:A0A0H2ZKK6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK6"
FT                   /protein_id="ABJ15230.1"
FT                   /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLGVRCDARLVLCGDGGEA
FT                   LAHCRRRRFALILAELNLPQVDGFELLREARLRRSVAEQPFILISDRADQASVRAAVAL
FT                   APTAYLVKPFQAENLMQRLRGLLLKGDEVVACPLPERDAGENLEAFLERARDSAEGAPL
FT                   LADVRAASDRCLSAEEHPLRVLEDEFGRDPQITAGLIAAANSAARHVGPACQTLGQALR
FT                   RLGLGHSLNLVLGFSLQRAIQLGEPLLAERAMHFWDLSQRCADIAWELADALGADVERC
FT                   YTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDELLGRFGASFGSALRARWRLPLELR
FT                   RLIAAAYQFGGVLSREELILSLATQAASLPEDDAEQLAESKAARMLGLDGERLAKLLQP
FT                   "
FT   gene            complement(318332..319753)
FT                   /locus_tag="PA14_03480"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0268"
FT   CDS_pept        complement(318332..319753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03480"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15231"
FT                   /db_xref="GOA:A0A0H2ZKX0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX0"
FT                   /protein_id="ABJ15231.1"
FT                   /translation="MELQLILDGRHDLVGQLYRQLRDAILHGRLATGDRLPATRYLAER
FT                   LEVSRKTVSEAYERLTSEGFLEGRVGSGTFVARGPAGEAPPQRADGPLRPAARWARIEP
FT                   QSGLMDQRAPLRYSFAGGTTDKRRFPFDTWRTCVLQALRLQQRSPAFYKETEGDPELRL
FT                   AISRYLAINRAVQCDWNALMVTQGAQQGLDLLARVMLDPGDLAVVEEPGYPPARASLLA
FT                   TGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQRHRAL
FT                   IIEDDYDSEYRFDGRSLESLRSLDRNGQVAYLGTFSKTLFPELRLGYLLPPASLREAVL
FT                   AARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRRRLLERLHGDLSPWLEA
FT                   LPAVAGIHLAARCREPLDVLRIARHLRQQGLEVGTLPPFYAETPAQAGFLFGFGCIERD
FT                   DIDPALDLLRAELRR"
FT   gene            319880..320317
FT                   /locus_tag="PA14_03490"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0269"
FT   CDS_pept        319880..320317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03490"
FT                   /product="putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15232"
FT                   /db_xref="GOA:A0A0H2ZK86"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK86"
FT                   /protein_id="ABJ15232.1"
FT                   /translation="MTTRLEWAKASPDAYAAMLGLEKALAKAGLERPLIELVYLRTSQI
FT                   NGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERAALAWTEQLARLSQGPLP
FT                   HGLLDELREHFDDKEIAELTLAVSAINAWNRFGVGMGMQPE"
FT   gene            320329..320736
FT                   /locus_tag="PA14_03510"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0270"
FT   CDS_pept        320329..320736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15233"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR8"
FT                   /protein_id="ABJ15233.1"
FT                   /translation="MKANRSIACLLLAALPTLASAHAAEKVETLRDQALAEIPGHRGLM
FT                   LTVSFKPGQVSAPHVHPGSVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVPHLLAR
FT                   NPDPMKPAKLLVWELLKEGDPILKPLERGAH"
FT   gene            320770..321054
FT                   /locus_tag="PA14_03520"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0271"
FT   CDS_pept        320770..321054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15234"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR0"
FT                   /protein_id="ABJ15234.1"
FT                   /translation="MSASQVIRIRARNGQSERLGLRLQQLVEPGLEAPGCLEYQVRRDA
FT                   LEPDLWLVCSQWREAQQMFDYLAGGIQQVFAEVLWRSLAASLEVQDDAG"
FT   gene            complement(321051..321983)
FT                   /locus_tag="PA14_03530"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   PA0272"
FT   CDS_pept        complement(321051..321983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03530"
FT                   /product="Probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15235"
FT                   /db_xref="GOA:A0A0H2ZKL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL0"
FT                   /protein_id="ABJ15235.1"
FT                   /translation="MLIANGLRKVDMQDLLVFLQVHQRQNLVEVAEQLNLSPSTVSYCL
FT                   KKLRQAFDDELFIATRGGMQPTHKSRAMLPHVEEMLARINACHAAQGSFDPRGEPRTFT
FT                   LCAPEYVELLILPALLRRLAANGPRIGLDIRRLGPELPTEALLDGQVDLVFDFGPEYHR
FT                   PAPELQALALFSDELLCVQDRAQPRHERLELDEFCRRRFVFPTPLDASNANLVDTWLRR
FT                   QGRSREVAARANSYVAALQLLSGSDFVLMLPRRIHALLDDGRHRACLAPSGLPPFALHL
FT                   SWSRAADQDPANLWLREQVLIVCAELGLL"
FT   gene            complement(322033..323247)
FT                   /gene="cynX"
FT                   /locus_tag="PA14_03550"
FT   CDS_pept        complement(322033..323247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="PA14_03550"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15236"
FT                   /db_xref="GOA:A0A0H2ZKX4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX4"
FT                   /protein_id="ABJ15236.1"
FT                   /translation="MPTANPPGRTLWLMAAIVLVGLNLRPSMAAVGPLLNAMRGEIALS
FT                   FGDVSLLTALPVLTLGLGMFFGLSIARRVGEWRSVALALLLIGAASALRLGSRGLPDLL
FT                   GSAMLAGLGIALIQALMPALIKARFGARTPLCMGLYVTAIMAGAALSASAAPTLAEHAG
FT                   WRLGLGAWAALAALALLAWWLQPGTRLRLPDAQPGRSLLRYPRTWLLILFFGLGTACYT
FT                   CVLAWLAPYYLEQGWSAQESGLLLGFLTAVEVLSGLLAPALASRSRDRRPVLVGLTALM
FT                   LAGFLGLAWAPASLPLLWALCLGLGIGGLFPMGLIVCLDHFDAPQRAGQLAALVQGAGY
FT                   LIAGVSPWIAGLLRDSLGSFTGAWLGLTTVAALLLGLGLRFDPRRYAALFAERQPQGVG
FT                   AESLR"
FT   gene            complement(323410..324180)
FT                   /locus_tag="PA14_03560"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0274"
FT   CDS_pept        complement(323410..324180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK91"
FT                   /protein_id="ABJ15237.1"
FT                   /translation="MPRPALPAVLCLCCLLLALPARAALDDQQRALQQLQVQACRAVGS
FT                   LLLLRGEGFQEQHAAQLEKDLASLDRALAAAPEGVLLRQGERALVARIREGAAYGPREE
FT                   DLPWRYPQQLSRALRDFLNLVERQVPPPPPGQPLPLWQLPVRVEYLSLQYLARAYLGGL
FT                   EIAREQPRDYLGQDESVLVPLIDRRIALLVAQSANPAGLKKLENRWEYLSQALRDLNSK
FT                   SSALVSASGRPWAPIIVDRHARALSESLMRLSAE"
FT   gene            complement(324289..324975)
FT                   /locus_tag="PA14_03580"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0275"
FT   CDS_pept        complement(324289..324975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03580"
FT                   /product="putative putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15238"
FT                   /db_xref="GOA:A0A0H2ZJS3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS3"
FT                   /protein_id="ABJ15238.1"
FT                   /translation="MNERTDYRSQLQAGRWFQGLPEALQTHLLALAQPRHLPPGQRLFA
FT                   RGDAPCGLYCVVEGAIRISAVSENGKEALLILVEAPHWFGEIALFDGQARTHDAYAEGH
FT                   TQLLQVPQAALLELLRREPHYWRDMALLMSHKLRLAFIALEEMALLPAAQRLARRLLML
FT                   AEGYDNSRSRQVLHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILDLAGL
FT                   RAATHG"
FT   gene            325051..325566
FT                   /locus_tag="PA14_03590"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0276"
FT   CDS_pept        325051..325566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03590"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15239"
FT                   /db_xref="GOA:A0A0H2ZKR7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR7"
FT                   /protein_id="ABJ15239.1"
FT                   /translation="MKTLVDHLAQYAAYHRDRRNIFSHFIGIPMIVLSIAVLLARPALG
FT                   FGLSPALLLALAAALFYLRLDLRFGAAMTALLALTVWGAAQLAAGTTAAWLGWGVGLFV
FT                   VGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGDVQREVEERAGPTC
FT                   IREHKRAA"
FT   gene            complement(325606..326364)
FT                   /gene="ycaL"
FT                   /locus_tag="PA14_03610"
FT   CDS_pept        complement(325606..326364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaL"
FT                   /locus_tag="PA14_03610"
FT                   /product="putative putative Zn-dependent protease with
FT                   chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15240"
FT                   /db_xref="GOA:A0A0H2ZKL4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL4"
FT                   /protein_id="ABJ15240.1"
FT                   /translation="MKTRLSLSALALACATLAGCQNLPQGDLMQHGMMAVKAATLSDAE
FT                   VRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEEVNAWA
FT                   MANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQTAYAAAAVRGAAGASKS
FT                   GALAALSGSQLGELTESLINAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEKLAKL
FT                   GGGDSSMFDSHPGSQARADHIRQRIAADRK"
FT   gene            complement(326536..327288)
FT                   /locus_tag="PA14_03620"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0278"
FT   CDS_pept        complement(326536..327288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03620"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15241"
FT                   /db_xref="GOA:A0A0H2ZKY0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY0"
FT                   /protein_id="ABJ15241.1"
FT                   /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPPM
FT                   QAAALLIVPSMVTNLWQLACGPRFLGLMKRLAGLLLGVVVGTLLVGAWLGGDAPRQATG
FT                   VLGLALAAYALLGLAAIPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLGALR
FT                   LQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQWLRQ
FT                   RISATLFRRCFFVGLLLLGADLAWRGFH"
FT   gene            327382..328080
FT                   /locus_tag="PA14_03630"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0279"
FT   CDS_pept        327382..328080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03630"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15242"
FT                   /db_xref="GOA:A0A0H2ZK94"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK94"
FT                   /protein_id="ABJ15242.1"
FT                   /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVSP
FT                   SSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALASASLALQPQRRSLPPSH
FT                   GTPSALREARTCYDHLAGELAVGVFARMLDAGWIEQEGRTLRLSATGEAGLAGLGIDLA
FT                   EVRRRRRQFACACPDWSERKPHLGGALGAALLEACLRQGWLRPQDGSRALQVSPKGRAG
FT                   LRGLAERTAG"
FT   gene            complement(328093..329082)
FT                   /gene="cysA"
FT                   /locus_tag="PA14_03650"
FT   CDS_pept        complement(328093..329082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PA14_03650"
FT                   /product="sulfate transport protein CysA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15243"
FT                   /db_xref="GOA:A0A0H2ZJS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS9"
FT                   /protein_id="ABJ15243.1"
FT                   /translation="MSIEIRNVSKNFNAFKALDDINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   GERPGESAIKAKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLLDEP
FT                   FGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLQLGNDQHLLFRPHEVSLSRSAVAEHRAAEVRDIRPLGA
FT                   ITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
FT   gene            complement(329086..329955)
FT                   /gene="cysW"
FT                   /locus_tag="PA14_03670"
FT   CDS_pept        complement(329086..329955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PA14_03670"
FT                   /product="sulfate transport protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15244"
FT                   /db_xref="GOA:A0A0H2ZKS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS1"
FT                   /protein_id="ABJ15244.1"
FT                   /translation="MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVVL
FT                   SEALKQGFGTFFEAILEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGKSI
FT                   LVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVTVPF
FT                   VARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFG
FT                   AVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSR
FT                   LKSNADEE"
FT   gene            complement(329966..330784)
FT                   /gene="cysT"
FT                   /locus_tag="PA14_03680"
FT   CDS_pept        complement(329966..330784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PA14_03680"
FT                   /product="sulfate transport protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15245"
FT                   /db_xref="GOA:A0A0H2ZKL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL7"
FT                   /protein_id="ABJ15245.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWEQ
FT                   FWAIISAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
FT   gene            complement(330946..331944)
FT                   /gene="sbp"
FT                   /locus_tag="PA14_03700"
FT   CDS_pept        complement(330946..331944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PA14_03700"
FT                   /product="sulfate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15246"
FT                   /db_xref="GOA:A0A0H2ZKY4"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY4"
FT                   /protein_id="ABJ15246.1"
FT                   /translation="MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAF
FT                   IKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADW
FT                   QARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAW
FT                   AWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKK
FT                   EQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFY
FT                   RPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ"
FT   gene            complement(332121..332303)
FT                   /locus_tag="PA14_03710"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0284"
FT   CDS_pept        complement(332121..332303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15247"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK99"
FT                   /protein_id="ABJ15247.1"
FT                   /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQIE
FT                   RKEKFRLQQPAVKQA"
FT   gene            complement(332467..334749)
FT                   /locus_tag="PA14_03720"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0285"
FT   CDS_pept        complement(332467..334749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03720"
FT                   /product="putative sensory box/GGDEF domain/EAL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15248"
FT                   /db_xref="GOA:A0A0H2ZJT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT3"
FT                   /protein_id="ABJ15248.1"
FT                   /translation="MSPRLSALRLSLAYLAIAIAWAFLSDHLLQNQVQDHDQLVFWMTA
FT                   KRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTDRM
FT                   FVSPGYAALIGLAPEELGDPIETWKKRLHPEEYATVLEAHRNHLQGLTDNLDHIYRLRH
FT                   KDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREGVLVT
FT                   DAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDVWSGEI
FT                   WNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHDSLTGLP
FT                   NRVLLRERIEQALENGKDRTVAGALLLIDLDHFKHINDSLGHTTGDMLLKEVSKRLQHQ
FT                   LDERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYISASLGVSL
FT                   YPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESALRHALEHDE
FT                   LRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIAALDNWVLKRA
FT                   CRQMREWQQRGVELEFVAVNVSSRLFNRGGLEERIANALEESGLEPRYLELEVTESAVM
FT                   EDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQGFVAGLPGAVDD
FT                   AAIARAIVALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYGRPQPAEALRFDLP
FT                   PVALPED"
FT   gene            334920..336098
FT                   /locus_tag="PA14_03730"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0286"
FT   CDS_pept        334920..336098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03730"
FT                   /product="putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15249"
FT                   /db_xref="GOA:A0A0H2ZKS5"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS5"
FT                   /protein_id="ABJ15249.1"
FT                   /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDLH
FT                   PALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAELYK
FT                   AEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQMAW
FT                   IPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVKK
FT                   WEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMAQYRKL
FT                   VIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQALKVIYEK
FT                   RLALQQIWAKTSANGHDMLAAIKDWVHEAEASGIQSLKEFAAQLKTYSLRPA"
FT   gene            336327..337712
FT                   /locus_tag="PA14_03760"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0287"
FT   CDS_pept        336327..337712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03760"
FT                   /product="putative sodium:solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15250"
FT                   /db_xref="GOA:A0A0H2ZKM1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM1"
FT                   /protein_id="ABJ15250.1"
FT                   /translation="MLLDYLIMLVYALAMLGLGWYGMRKAKSQSDFLVAGRRLGPGLYL
FT                   GTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTVTQ
FT                   VLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIVIVY
FT                   SVIGGMWSLTLTDIIQFVIKTVGIFLVLLPLSIDGAGGLARMQEVLPAGFFDLGHIGLD
FT                   TILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGAACALIGAAARV
FT                   LLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQEDIYARF
FT                   LRPGTTSDIRLSRCITLLMGVAMLVLACLVNDVIAALSIAYNLLVGGLLVPIVGALLWR
FT                   RASPQGAIASIVAGCLAVIACMARDGLLANSPIVYGLLASLATFVAVSLATRPAASLRA
FT                   QPE"
FT   gene            337768..338724
FT                   /gene="speB1"
FT                   /locus_tag="PA14_03770"
FT   CDS_pept        337768..338724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB1"
FT                   /locus_tag="PA14_03770"
FT                   /product="agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15251"
FT                   /db_xref="GOA:A0A0H2ZKZ0"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ0"
FT                   /protein_id="ABJ15251.1"
FT                   /translation="MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWD
FT                   GGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRR
FT                   IEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPY
FT                   THGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEAT
FT                   LAEARRVVGDGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGAD
FT                   VVEVSPPFDVGGATALVGATMMFELLCLLAESAARSA"
FT   gene            338777..339739
FT                   /locus_tag="PA14_03780"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0289"
FT   CDS_pept        338777..339739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03780"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15252"
FT                   /db_xref="GOA:A0A0H2ZKA3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA3"
FT                   /protein_id="ABJ15252.1"
FT                   /translation="MRAGMLGNLNDIDLRMLRTFCAIVEAGGFTAAQARLNTSLSRLSV
FT                   LVRDLEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDREAL
FT                   HLGCVDGVIGQHCLPLPLAIRLFRQRAPEVLLKLHTRRPDELEHAVLEERLQLAVGAFH
FT                   HRLSGLYYQPLFREEQNLYCGSAHPFFARADDEPALDEICAADYVGRGYMAENHRPHDL
FT                   RFNQGTDAYTMEAIATLVFSGTYIGYLPTHYAATWVAEGRMRAIRPRQLAYDSEFHCIT
FT                   RQGHEERPTLTLFLRSLFEAQKQLGVQVPANTNGIARQL"
FT   gene            339852..340823
FT                   /locus_tag="PA14_03790"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0290"
FT   CDS_pept        339852..340823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03790"
FT                   /product="putative sensory box/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15253"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT9"
FT                   /protein_id="ABJ15253.1"
FT                   /translation="MDDLPGIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNSV
FT                   LWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLLQVLERG
FT                   AVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKHMESELQRLAT
FT                   TDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQVLQR
FT                   IAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEGEQSFG
FT                   ITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
FT   gene            341437..342828
FT                   /gene="oprE"
FT                   /locus_tag="PA14_03800"
FT   CDS_pept        341437..342828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprE"
FT                   /locus_tag="PA14_03800"
FT                   /product="anaerobically-induced outer membrane porin OprE
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15254"
FT                   /db_xref="GOA:A0A0H2ZKS8"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS8"
FT                   /protein_id="ABJ15254.1"
FT                   /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRNF
FT                   YINTDNRNGSASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAGKS
FT                   GLGLDRQPGTVFPLESNGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGRL
FT                   LPVTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSAGSRDSNKFYY
FT                   AGGDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGKNGS
FT                   RSGRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFPFLNR
FT                   GDGEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFAGLGLPGLTFNTMYLKGDNIKSGR
FT                   GDQSEWERDIALAYVIPDGTFKGLGFTWKNASFRTGLPVSGSGTATQRDQDENRLIVSY
FT                   TLPLL"
FT   gene            complement(342926..344032)
FT                   /gene="aguA"
FT                   /locus_tag="PA14_03810"
FT   CDS_pept        complement(342926..344032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="PA14_03810"
FT                   /product="agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15255"
FT                   /db_xref="GOA:Q02UC5"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UC5"
FT                   /protein_id="ABJ15255.1"
FT                   /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQA
FT                   AFAAVAKAIARFEPVTVCASAGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVIDD
FT                   KGDVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVD
FT                   GEGTLITTEECLLNHNRNPHLSQVEIERTLRDYLAVDSIIWLPNGLYNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEE
FT                   CDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPKDAEARAILQRVFPEHEV
FT                   VMVPGREILLGGGNIHCITQQQPAPRKA"
FT   gene            complement(344118..344996)
FT                   /gene="aguB"
FT                   /locus_tag="PA14_03830"
FT   CDS_pept        complement(344118..344996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguB"
FT                   /locus_tag="PA14_03830"
FT                   /product="N-carbamoylputrescine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15256"
FT                   /db_xref="GOA:A0A0H2ZKM5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM5"
FT                   /protein_id="ABJ15256.1"
FT                   /translation="MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQEL
FT                   FETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAV
FT                   IDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESA
FT                   RSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQD
FT                   GYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYG
FT                   PLKTLDGSLES"
FT   gene            complement(345159..345824)
FT                   /gene="aguR"
FT                   /locus_tag="PA14_03840"
FT   CDS_pept        complement(345159..345824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguR"
FT                   /locus_tag="PA14_03840"
FT                   /product="transcriptional regulator AguR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15257"
FT                   /db_xref="GOA:A0A0H2ZKZ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ5"
FT                   /protein_id="ABJ15257.1"
FT                   /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLTIYSVAER
FT                   AEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLA
FT                   VYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLA
FT                   MELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLTGFISDLNR"
FT   gene            complement(345887..346948)
FT                   /locus_tag="PA14_03855"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0295"
FT   CDS_pept        complement(345887..346948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03855"
FT                   /product="probable periplasmic polyamine binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03855"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15639"
FT                   /db_xref="GOA:A0A0H2ZM12"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZM12"
FT                   /protein_id="ABJ15639.1"
FT                   /translation="MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTG
FT                   IRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDR
FT                   QLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKS
FT                   CGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLE
FT                   GGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYL
FT                   MQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPV
FT                   VDEIWKAFRGASH"
FT   gene            complement(347204..348580)
FT                   /locus_tag="PA14_03860"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0296"
FT   CDS_pept        complement(347204..348580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03860"
FT                   /product="putative glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15258"
FT                   /db_xref="GOA:A0A0H2ZKA8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA8"
FT                   /protein_id="ABJ15258.1"
FT                   /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERN
FT                   SLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPT
FT                   AQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQP
FT                   PRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLN
FT                   HVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNI
FT                   FTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTV
FT                   ALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQME
FT                   PSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
FT                   "
FT   gene            348859..349611
FT                   /gene="spuA"
FT                   /gene_synonym="guaA"
FT                   /locus_tag="PA14_03870"
FT   CDS_pept        348859..349611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuA"
FT                   /gene_synonym="guaA"
FT                   /locus_tag="PA14_03870"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15259"
FT                   /db_xref="GOA:A0A0H2ZJU4"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU4"
FT                   /protein_id="ABJ15259.1"
FT                   /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPA
FT                   LGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAID
FT                   AGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPG
FT                   GVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHP
FT                   EWQVLTNPNYLAIFQAFGKACSKRAGQR"
FT   gene            349652..351010
FT                   /gene="spuB"
FT                   /gene_synonym="glnA"
FT                   /locus_tag="PA14_03880"
FT   CDS_pept        349652..351010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuB"
FT                   /gene_synonym="glnA"
FT                   /locus_tag="PA14_03880"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15260"
FT                   /db_xref="GOA:A0A0H2ZKT2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT2"
FT                   /protein_id="ABJ15260.1"
FT                   /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEK
FT                   GMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHD
FT                   TFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRS
FT                   GRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALD
FT                   LADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADG
FT                   TMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPD
FT                   SSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLT
FT                   IEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV"
FT   gene            351076..352446
FT                   /gene="spuC"
FT                   /locus_tag="PA14_03900"
FT   CDS_pept        351076..352446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuC"
FT                   /locus_tag="PA14_03900"
FT                   /product="putrescine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15261"
FT                   /db_xref="GOA:A0A0H2ZKM9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM9"
FT                   /protein_id="ABJ15261.1"
FT                   /translation="MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGV
FT                   YIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAK
FT                   AIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAG
FT                   VSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEEN
FT                   VAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYG
FT                   NAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIR
FT                   ILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDK
FT                   GVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA"
FT   gene            352562..353665
FT                   /gene="spuD"
FT                   /locus_tag="PA14_03920"
FT   CDS_pept        352562..353665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuD"
FT                   /locus_tag="PA14_03920"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15262"
FT                   /db_xref="GOA:Q02UB7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UB7"
FT                   /protein_id="ABJ15262.1"
FT                   /translation="MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLE
FT                   KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKL
FT                   PNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFK
FT                   PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFH
FT                   SSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPK
FT                   DAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMK
FT                   KLYTFPDLPAKTQRAMTRSWTKIKSGK"
FT   gene            354084..355181
FT                   /gene="spuE"
FT                   /gene_synonym="potF2"
FT                   /locus_tag="PA14_03930"
FT   CDS_pept        354084..355181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuE"
FT                   /gene_synonym="potF2"
FT                   /locus_tag="PA14_03930"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15263"
FT                   /db_xref="GOA:A0A0H2ZL00"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL00"
FT                   /protein_id="ABJ15263.1"
FT                   /translation="MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKD
FT                   FTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLP
FT                   NWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPE
FT                   NMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSS
FT                   KYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADA
FT                   KAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKL
FT                   YVSAVLPAKVLRLQTRTWTRIKTGK"
FT   gene            355236..356390
FT                   /gene="spuF"
FT                   /gene_synonym="potG"
FT                   /locus_tag="PA14_03940"
FT   CDS_pept        355236..356390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuF"
FT                   /gene_synonym="potG"
FT                   /locus_tag="PA14_03940"
FT                   /product="polyamine transport protein PotG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15264"
FT                   /db_xref="GOA:A0A0H2ZKB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB1"
FT                   /protein_id="ABJ15264.1"
FT                   /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYA
FT                   LFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENP
FT                   IYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVY
FT                   YIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
FT   gene            356417..357298
FT                   /gene="spuG"
FT                   /gene_synonym="potH"
FT                   /locus_tag="PA14_03950"
FT   CDS_pept        356417..357298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuG"
FT                   /gene_synonym="potH"
FT                   /locus_tag="PA14_03950"
FT                   /product="polyamine transport protein PotH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15265"
FT                   /db_xref="GOA:A0A0H2ZJU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU9"
FT                   /protein_id="ABJ15265.1"
FT                   /translation="MPTGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEADVAIPPYTEI
FT                   FAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFISTLICLLVGYPMAYAIARSS
FT                   QSSQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGLISEPLTILNTNIAV
FT                   YIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPLSKNGIIAGCM
FT                   LVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILIIPIILF
FT                   NKNQAKELEGKV"
FT   gene            357381..358250
FT                   /gene="spuH"
FT                   /gene_synonym="potI"
FT                   /locus_tag="PA14_03960"
FT   CDS_pept        357381..358250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuH"
FT                   /gene_synonym="potI"
FT                   /locus_tag="PA14_03960"
FT                   /product="polyamine transport protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15266"
FT                   /db_xref="GOA:A0A0H2ZKT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT6"
FT                   /protein_id="ABJ15266.1"
FT                   /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSVK
FT                   WYVGLLDNTQLVSSVGRSLEIAFYTAFSSVLLGTLAAFVLTRIPRFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFFAWYFTRQAEERRRRAIQQAMEETATDW
FT                   QKGSPTPA"
FT   gene            complement(358448..360835)
FT                   /locus_tag="PA14_03980"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0305"
FT   CDS_pept        complement(358448..360835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_03980"
FT                   /product="putative penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15267"
FT                   /db_xref="GOA:A0A0H2ZKN4"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN4"
FT                   /protein_id="ABJ15267.1"
FT                   /translation="MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDV
FT                   RYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRL
FT                   FRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTP
FT                   EDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGD
FT                   WKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYE
FT                   AQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQ
FT                   GKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENP
FT                   VLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSF
FT                   ILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWL
FT                   DTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWK
FT                   GDYPVDSTAATLFNQLLFQIAESALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWW
FT                   DDRRTERRETRADIVRAAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLKR
FT                   LLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGV
FT                   PFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
FT   gene            360946..361998
FT                   /locus_tag="PA14_04000"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0306"
FT   CDS_pept        360946..361998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04000"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15268"
FT                   /db_xref="GOA:A0A0H2ZL05"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL05"
FT                   /protein_id="ABJ15268.1"
FT                   /translation="MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLP
FT                   PPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEAL
FT                   RSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISD
FT                   DEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHGV
FT                   LTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGAS
FT                   FRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAK
FT                   REEGYSTSGT"
FT   gene            complement(361977..362480)
FT                   /locus_tag="PA14_04010"
FT   CDS_pept        complement(361977..362480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB4"
FT                   /protein_id="ABJ15269.1"
FT                   /translation="MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLAD
FT                   VDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSD
FT                   DQASTLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQV
FT                   PLVE"
FT   gene            complement(362585..363196)
FT                   /locus_tag="PA14_04020"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0307"
FT   CDS_pept        complement(362585..363196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15271"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU0"
FT                   /protein_id="ABJ15271.1"
FT                   /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYI
FT                   RPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGV
FT                   EFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAV
FT                   CTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG"
FT   gene            363195..364214
FT                   /locus_tag="PA14_04030"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0308"
FT   CDS_pept        363195..364214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04030"
FT                   /product="putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15270"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV5"
FT                   /protein_id="ABJ15270.1"
FT                   /translation="MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAA
FT                   AEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGY
FT                   YDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAEL
FT                   DLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPF
FT                   VDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLV
FT                   VQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA"
FT   gene            complement(364234..364986)
FT                   /locus_tag="PA14_04040"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0309"
FT   CDS_pept        complement(364234..364986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN8"
FT                   /protein_id="ABJ15272.1"
FT                   /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQ
FT                   KRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVV
FT                   AAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADS
FT                   LSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFA
FT                   ESPSGRSYYQAALAALKAGLAVDQAVAP"
FT   gene            365035..365733
FT                   /locus_tag="PA14_04050"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0310"
FT   CDS_pept        365035..365733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04050"
FT                   /product="putative proline hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15273"
FT                   /db_xref="GOA:A0A0H2ZL10"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL10"
FT                   /protein_id="ABJ15273.1"
FT                   /translation="MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGW
FT                   SHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESV
FT                   ACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVL
FT                   YLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFR
FT                   RRNESLLQLS"
FT   gene            complement(365755..366309)
FT                   /locus_tag="PA14_04060"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0311"
FT   CDS_pept        complement(365755..366309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB9"
FT                   /protein_id="ABJ15274.1"
FT                   /translation="MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISL
FT                   RLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIF
FT                   GVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNS
FT                   IGRIELRDITDLRGTIKVWGH"
FT   gene            366575..367069
FT                   /locus_tag="PA14_04070"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0312"
FT   CDS_pept        366575..367069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15275"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW0"
FT                   /protein_id="ABJ15275.1"
FT                   /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVA
FT                   GGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAV
FT                   LKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAG
FT                   G"
FT   gene            complement(367074..367766)
FT                   /gene="yecS"
FT                   /locus_tag="PA14_04080"
FT   CDS_pept        complement(367074..367766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yecS"
FT                   /locus_tag="PA14_04080"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15276"
FT                   /db_xref="GOA:A0A0H2ZKU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU5"
FT                   /protein_id="ABJ15276.1"
FT                   /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLI
FT                   LGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILA
FT                   LTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSL
FT                   ISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALEN
FT                   RLTAPLRR"
FT   gene            complement(367838..368608)
FT                   /gene="fliY"
FT                   /locus_tag="PA14_04090"
FT   CDS_pept        complement(367838..368608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="PA14_04090"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15277"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP3"
FT                   /protein_id="ABJ15277.1"
FT                   /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNF
FT                   KQGGKLTGFETELGELLAAELEVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRK
FT                   VFDFSEPYTISSAQLIVRADDTRQFRSLEDLKGLKLGVGQGTNYADLAKSVAGVNVRTY
FT                   PGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKNNPKF
FT                   GEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK"
FT   gene            368901..369338
FT                   /locus_tag="PA14_04100"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0315"
FT   CDS_pept        368901..369338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15278"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL15"
FT                   /protein_id="ABJ15278.1"
FT                   /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPADG
FT                   ATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFGKG
FT                   QTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
FT   gene            complement(369396..370625)
FT                   /gene="serA"
FT                   /locus_tag="PA14_04110"
FT   CDS_pept        complement(369396..370625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="PA14_04110"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15279"
FT                   /db_xref="GOA:A0A0H2ZKC4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC4"
FT                   /protein_id="ABJ15279.1"
FT                   /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSGD
FT                   ELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYGSIG
FT                   TQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQWMIG
FT                   EKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEEFASPL
FT                   RGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPSHPGKHR
FT                   LLHIHANIPGVMSEINKVFADNGINVSGQYLQTNDKVGYVVIDVDAEYSDLALEKLQQV
FT                   NGTIRSRVLF"
FT   gene            370829..372223
FT                   /locus_tag="PA14_04140"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0317"
FT   CDS_pept        370829..372223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04140"
FT                   /product="putative oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15280"
FT                   /db_xref="GOA:A0A0H2ZJW5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW5"
FT                   /protein_id="ABJ15280.1"
FT                   /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAIV
FT                   FPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDFNAFD
FT                   RTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMTRNW
FT                   VAGMKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPKNLTA
FT                   MVLGTPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPFYALLE
FT                   FEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISHWTPYKN
FT                   DISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGKDEFFARC
FT                   ATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVFDPNGIMNP
FT                   GKIFAE"
FT   gene            372315..372980
FT                   /gene="ycgM"
FT                   /locus_tag="PA14_04150"
FT   CDS_pept        372315..372980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /locus_tag="PA14_04150"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15281"
FT                   /db_xref="GOA:A0A0H2ZKV0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV0"
FT                   /protein_id="ABJ15281.1"
FT                   /translation="MSYQHQYIDGTPIHFPLGKLVCVGRNYAEHAKELNNPVPTEPLLF
FT                   IKPGSCVVPVSGGLSLPQERGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPALDL
FT                   TLREVQAKLKEKGLPWELAKSFDGAGVLSPFVNADQFPDPTDIGIRLTINGEVRQDGNS
FT                   RDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLNSGDELLLELPGASRFETRVL"
FT   gene            373079..374068
FT                   /locus_tag="PA14_04160"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0319"
FT   CDS_pept        373079..374068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04160"
FT                   /product="putatitve transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15282"
FT                   /db_xref="GOA:A0A0H2ZKP7"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP7"
FT                   /protein_id="ABJ15282.1"
FT                   /translation="MPFHGDAQENTWPNSRASPMSLASKLPRFRWLLPAFVVLVGVVLT
FT                   IVMHWDDRAGLWWKESQASQQQRDDSIWLPGYRVVIDAKPLQGLEEEETSDLAYNPATR
FT                   TLFTVTGKRPLLVELSLTGDVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTIFHV
FT                   DPQTAELSTKSLAEFPLGNIGKKNKGFEGIAWDPRQQRLLLSKERDPMTLFSWKSDGGP
FT                   SLSGAMTALPSDDLYMRNVSALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFISLLGG
FT                   FNGLDSKIPRAEGVAIDDEGTIYMVSEPNLFYVFRKKSGERLATSDAD"
FT   gene            374152..374502
FT                   /locus_tag="PA14_04180"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0320"
FT   CDS_pept        374152..374502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15283"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL19"
FT                   /protein_id="ABJ15283.1"
FT                   /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAADD
FT                   TPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTRVKLTGEVDRDLVG
FT                   REIDVEFVEVIK"
FT   gene            complement(374583..375617)
FT                   /gene="aphA"
FT                   /locus_tag="PA14_04190"
FT   CDS_pept        complement(374583..375617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="PA14_04190"
FT                   /product="acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15284"
FT                   /db_xref="GOA:A0A0H2ZKC9"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC9"
FT                   /protein_id="ABJ15284.1"
FT                   /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRVKAVGL
FT                   GEVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLATGRSHDMLPIAWPTRRLRQTEPDN
FT                   IDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELANGARSVFSLCRPPGHHAAAD
FT                   YMGGYCFFNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIHGDPR
FT                   FEYPYFLGYADEKGNGVGTGYNFNYPLAAGSDWATWSQALQAAIRQIQAYAADVLIVSL
FT                   GVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFVMEGGYAVEEIGINAVNVLQGFE
FT                   GVHR"
FT   gene            complement(375633..377027)
FT                   /locus_tag="PA14_04210"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0322"
FT   CDS_pept        complement(375633..377027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04210"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15285"
FT                   /db_xref="GOA:A0A0H2ZJX0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX0"
FT                   /protein_id="ABJ15285.1"
FT                   /translation="MASQRNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYMV
FT                   PLTMFTTYGVVTEITGGRTASAYLITLAAMLFTAFSYSFMVKKYPIAGSAYSYTSLSFG
FT                   PCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLTAIGLVTVLNVIGIS
FT                   SVAGMSNVIVGAQFVFAVVFVAMAVKHLAGIPSLDLSLPFVGDGSQPGFAPLMAGAAVL
FT                   CLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSVFQDAE
FT                   SAANEVMLAAGGKFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRVFGSL
FT                   SERFKTPVIAILVVSVISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSYLLLDGRR
FT                   APRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLTWFAAGLAYLALHTGGFRRKAPTV
FT                   TFSEQN"
FT   gene            complement(377448..378491)
FT                   /locus_tag="PA14_04220"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0323"
FT   CDS_pept        complement(377448..378491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04220"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15286"
FT                   /db_xref="GOA:A0A0H2ZKV5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV5"
FT                   /protein_id="ABJ15286.1"
FT                   /translation="MTYRTPLTLLFAAGLALGGQARAEGTLHFANWSDYYPPELLKKFE
FT                   KDTGIKATLDAYDSNETLLAKLKAGGGAYDVVVPSDSFIEIFVKEGLLQKLDKSQLPSL
FT                   GNLKENFRTLGFDPGHDYSIPYLWGTTGYSYDTAKVPGGRLEESWKPFFEPPAELKGKV
FT                   VALNSIEELFIPATYYLGIDECTEDAREAQKVLDLLLRQKPALAMYNSDGTIERMAAGE
FT                   VAMHQQWNGAFHRAHAQRPSLEYVYPKEGIRLFIDNFAIPRDASNVKEAHVFIDWMMRP
FT                   ENIAAASNFAKYNNAIVGSEKFMEKALFDDPAINTPQDKLNRLKPFKLCSPKALALRSK
FT                   VWTKLKK"
FT   gene            complement(378539..379327)
FT                   /locus_tag="PA14_04230"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0324"
FT   CDS_pept        complement(378539..379327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04230"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15287"
FT                   /db_xref="GOA:A0A0H2ZKQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ2"
FT                   /protein_id="ABJ15287.1"
FT                   /translation="MNGRNPLWTFSGVRQAAWLFFAFLYIPILVLVALSFNSGQSATLW
FT                   ESFSLKWYAVVANDPEILRAAKNSLIVATLATLASTVLATLAALGMRGRAFRGQTLMNG
FT                   VLGLPLLVPEIVTAVATLMFFSFIGLKLSLFTILIAHIVFCIPFAYLPIRARLEGLDPR
FT                   LAEAAADLYASPWKAFWKITLPLLMPGVLSGAMLAFIISMDDFVITYFVAGAGATTLPV
FT                   YIFSSIRMGISPKINAISSIILMISIAFVALSYYLGQRRR"
FT   gene            complement(379324..380253)
FT                   /locus_tag="PA14_04240"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0325"
FT   CDS_pept        complement(379324..380253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04240"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15288"
FT                   /db_xref="GOA:A0A0H2ZL22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL22"
FT                   /protein_id="ABJ15288.1"
FT                   /translation="MSATGRPSAQQSAERRQLRRRLLLSSPAMLMLVLFLVIPLGIMFA
FT                   VSIQQSGDYGGVKWGQHSLEAYLNFLWERDLDDSLVFNADYLGIFQRSFWLSLLTTLGC
FT                   LALGFPTALYLALQPERRRNLLLFLVTVPFWTNLLVRVYAWILLLRNGGLVDAGLQGIG
FT                   LTDTGLGLLYTDNAVIIGLLYTYLPFMVLPIYTSLEKMDWRLVEATFDLGANRWKALRR
FT                   VIVPLAMPGIVAGCILVFIPALGSYIIPELLGGGKALMIGNLIQLQFGTAHNWPFGAAL
FT                   SFALLAFVLLAMLIHSLRFRANAGGGQP"
FT   gene            complement(380250..381299)
FT                   /locus_tag="PA14_04250"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0326"
FT   CDS_pept        complement(380250..381299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04250"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15289"
FT                   /db_xref="GOA:A0A0H2ZKD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD3"
FT                   /protein_id="ABJ15289.1"
FT                   /translation="MTSAIAIERICMEFGTPGQGLKALDDVSLDIHANEFFTLLGPSGC
FT                   GKTTLLRLIAGFEQPSSGSIRLYGERMEGLPPFRRPVNTVFQSYALFPHMSVAENIGFG
FT                   LEMQGRPRSEIDATVSRMLELVKLPEVGKRRADQLSGGQQQRIALARALASRPKVLLLD
FT                   ESLSALDLKLRKEMQIELKRLQHETGITFIFVTHDQEEALTMSDRIAVMSKGKVLQVGT
FT                   PSDIYEAPLNRAVADFIGETNFLEGQADADGVRLADGQRLAATTPGSGAVTLAIRPERT
FT                   ELAADGQLEGVLENVVYVGTDTVYHLNVAGQPGFRVRQQNRDGARCPHSPGAKVRVRVP
FT                   AAAIRVLAE"
FT   gene            381627..382592
FT                   /locus_tag="PA14_04270"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0327"
FT   CDS_pept        381627..382592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04270"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15290"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX5"
FT                   /protein_id="ABJ15290.1"
FT                   /translation="MTIHAQTPEPFSMSRAFTPRRLLLAVLLVALTALVLLGQSFRVFD
FT                   RAWFAVQEWRHADAWKERSIWLPDYRVRIEAQPIEGLNDDVSALTFDPDRRTLFTVTNQ
FT                   PAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDERQQRLVKVRLEDDTRFID
FT                   AADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAV
FT                   HVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSLLRGMH
FT                   GLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
FT   gene            complement(382631..384574)
FT                   /locus_tag="PA14_04290"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0328"
FT   CDS_pept        complement(382631..384574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04290"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15291"
FT                   /db_xref="GOA:A0A0H2ZKW1"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW1"
FT                   /protein_id="ABJ15291.1"
FT                   /translation="MFKPLAVAVGLGCAALSLGANAYQYGEYAGETLERLITDYPGRYR
FT                   GTASFAGASELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKFLVLGAHYDTY
FT                   YGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVESLDA
FT                   SQRANLLGMINLDSLVTGDKMYAHAGSNSVSNPALGAYREQILRIARELDIPLFTNPGL
FT                   NAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTWHDPAE
FT                   DNKEVLTNALGQERIEQRMRDFSRLLTRLVLELTNADLLASTASGGALARQMEDQLQRQ
FT                   HQALTRLHDRRWLTLLGSNRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRAGVHLLGD
FT                   YRYSEALTLGGSLAFQRSRDKLDHGGRIEGDTWQLGLFGLYNDGGPEWLAGELNLGHTR
FT                   YDSKRSVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGPLAGLDYMRY
FT                   RIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYASLRWVRELAD
FT                   GRLEDMDLTSRGDGRVRVADMGGVDKDFGRAQLGAQLAITEQLGVFAEANSRFAHSEGN
FT                   QAGYSLGVNWQF"
FT   gene            complement(384875..385207)
FT                   /locus_tag="PA14_04300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0329"
FT   CDS_pept        complement(384875..385207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15292"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ5"
FT                   /protein_id="ABJ15292.1"
FT                   /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALGGIES
FT                   VRKNSQRDGAFEVKPANNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAPEA
FT                   GLSDES"
FT   gene            complement(385330..386001)
FT                   /gene="rpiA"
FT                   /locus_tag="PA14_04310"
FT   CDS_pept        complement(385330..386001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="PA14_04310"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15293"
FT                   /db_xref="GOA:Q02U86"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U86"
FT                   /protein_id="ABJ15293.1"
FT                   /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALAR
FT                   HKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGAAL
FT                   TREKIVAAVAKTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVYREG
FT                   VLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGVKTLK
FT                   A"
FT   gene            386260..387774
FT                   /gene="ilvA1"
FT                   /locus_tag="PA14_04320"
FT   CDS_pept        386260..387774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA1"
FT                   /locus_tag="PA14_04320"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15294"
FT                   /db_xref="GOA:A0A0H2ZL26"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL26"
FT                   /protein_id="ABJ15294.1"
FT                   /translation="MLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQVLLKREDLQ
FT                   PVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRAVIVMPKTTPE
FT                   IKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTIAGQGTVAMEIL
FT                   RQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGERVML
FT                   GQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITEPAGAL
FT                   AVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGERREAIIAVTIPERPG
FT                   SFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREALVAYLREKGFPVLDL
FT                   TDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLTKLGGRWNISMFHYRNH
FT                   GAADGRVVAGLQVPEDERHLIPQTLEAIGYPYWDETANPAYQLFLG"
FT   gene            387894..388361
FT                   /locus_tag="PA14_04330"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0332"
FT   CDS_pept        387894..388361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04330"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15295"
FT                   /db_xref="GOA:A0A0H2ZKD8"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD8"
FT                   /protein_id="ABJ15295.1"
FT                   /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARIARGF
FT                   KRVRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLVLAGRL
FT                   ARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
FT   gene            388412..389683
FT                   /locus_tag="PA14_04340"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0333"
FT   CDS_pept        388412..389683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04340"
FT                   /product="putative epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15296"
FT                   /db_xref="GOA:A0A0H2ZJY1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY1"
FT                   /protein_id="ABJ15296.1"
FT                   /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPVDAPAGVRWL
FT                   ALDLERLAERPDSFAWPAGVDLLINAAGTMSLDEASMARVQDSGARALFDLAAAHGAKV
FT                   LQISALGAGAHPDVTFLASKAAADRHLLELGIPALVLRPSLLLGPGGASSAWLERLSPL
FT                   PLIPLLDNRARLQPLHVEDLVGAVLALLRCWPERAQVIPLVGPQALTQGELLDELRRAQ
FT                   GWPRGRYVVPPAALLDALGGLGRRAGWRTLSPSMLKLVRHDNLADPALLDAACGYRCAP
FT                   LASRLLGWPQAARSLAALMRPLMLAALVLIWLGTLVACLGPGYGWGLRILGEAGIHGWP
FT                   ASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLAISLILPHYWYDPYMAVG
FT                   KNIVLMVATLWLLGDEPRAKEARG"
FT   gene            389680..390147
FT                   /locus_tag="PA14_04350"
FT   CDS_pept        389680..390147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04350"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15297"
FT                   /db_xref="GOA:A0A0H2ZKW5"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW5"
FT                   /protein_id="ABJ15297.1"
FT                   /translation="MNLYLLLKTLHILSSTILFGTGLGSAYYALRAWRSGQLPVIAVTF
FT                   RHLVTADWLFIATTAVFQPLSGLAMVHVAGWSLAQGWLLWSLGLYVFAGLCWLPVVWLQ
FT                   IRVRDMAEAALREARPIEPLAYRYMNAWFILGWPAFIAFMVIFYLMVNKPV"
FT   gene            complement(390120..391361)
FT                   /locus_tag="PA14_04370"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0334"
FT   CDS_pept        complement(390120..391361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04370"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15298"
FT                   /db_xref="GOA:A0A0H2ZKQ8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ8"
FT                   /protein_id="ABJ15298.1"
FT                   /translation="MPHTAPTPGSLRPVVIVALVTALCLAGDSMLYIALPIYWHEVGLE
FT                   ALWQVGVLLSINRLIRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFLAW
FT                   VLLRGLWGIGWSFFRIGGLSAVVYCAADHQRGHAMGLYNGLYRLGSLVGMLLGGLLVPV
FT                   LGLPALALSFAILALLGLPLLAKGFDLPENPAGQARTSAATASTSVARRPPPRGLVILS
FT                   GFATALLIQGVLAATLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPWLAGRF
FT                   GAWSDGPRGRRRFYVAALLVGAMGFGLLSSRLPILAWLAIALLVMLVATALTTLTDALA
FT                   ADVARAGDVVGFMTRYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAFLVLALLW
FT                   LRRADSQTGLLTIR"
FT   gene            complement(391411..392064)
FT                   /locus_tag="PA14_04380"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0335"
FT   CDS_pept        complement(391411..392064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04380"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15299"
FT                   /db_xref="GOA:A0A0H2ZL29"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL29"
FT                   /protein_id="ABJ15299.1"
FT                   /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFYA
FT                   DYVAGKLDVLAYQAFTQAILGRTDMAQLETWHRQFMQEVIEPIVLAKGEALLAEHRAAG
FT                   DRLVIITATNRFVTGPIAERLGVETLIATECEMRDGRYTGQTFDVPCFQGGKVVRLQRW
FT                   LDENGLNLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR"
FT   gene            392268..392747
FT                   /gene="ygdP"
FT                   /gene_synonym="nudH"
FT                   /locus_tag="PA14_04390"
FT   CDS_pept        392268..392747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygdP"
FT                   /gene_synonym="nudH"
FT                   /locus_tag="PA14_04390"
FT                   /product="dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15300"
FT                   /db_xref="GOA:Q02U79"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U79"
FT                   /protein_id="ABJ15300.1"
FT                   /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRET
FT                   PEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRL
FT                   MSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
FT   gene            392770..395049
FT                   /gene="ptsP"
FT                   /locus_tag="PA14_04410"
FT   CDS_pept        392770..395049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PA14_04410"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15301"
FT                   /db_xref="GOA:A0A0H2ZKE1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE1"
FT                   /protein_id="ABJ15301.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLDT
FT                   ETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIALFKQA
FT                   LEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQGALRQ
FT                   VVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVSEELSPA
FT                   MLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDLIVDGYHG
FT                   EVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTGLLADVARA
FT                   QERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPMISGTHELEEA
FT                   LHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWLLRQITLDKARDLLGQLLTFDNPQVIHSSLHLALRNLGLGRVINP
FT                   AATVQP"
FT   gene            395075..396205
FT                   /locus_tag="PA14_04420"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0338"
FT   CDS_pept        395075..396205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04420"
FT                   /product="putative sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15302"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY5"
FT                   /protein_id="ABJ15302.1"
FT                   /translation="MRRLRFPRKRIDCLPFGRGHWPVERARDCRKMDERASKPPGLLPL
FT                   SREDLEKTLRYALEIVSDGIWDWNIATNQVSRSAGWYLMLGYPPHSLPESVETWKNIIH
FT                   PEDYPRVMASFQAYLDGESPEYCEEYRCRTYSGDYLWISDRGRFVEFDERGEPRRMIGA
FT                   HHEIHQRKLVELELQQRNEELFDWNRRLEDLVAERTEALHRVNQALASKMAEAQRLSEI
FT                   DPLTELYNRRKFEQCLHHEWMRRQRHGRATALMMIDVDHFKRINDLFGHSTGDRVLVAF
FT                   GRLVASELREVDVLARWGGEEFILLLPETGLEAAAALAERLRQRVRSQSFEMGERLTAS
FT                   FGVGVLNDGETLDLLLCRVDDALYRAKQRRDCVACC"
FT   gene            complement(396209..396964)
FT                   /locus_tag="PA14_04430"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0339"
FT   CDS_pept        complement(396209..396964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15303"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW9"
FT                   /protein_id="ABJ15303.1"
FT                   /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFAG
FT                   RDLEAGGTWLGLGPAGRFAALTNVRDPSQALGKRSRGELVADFLRGGGNPADYLAQVAG
FT                   RAADYSGFNLLIGDRHQLWHYNPRVGPPRLLPAGVYGLSNAALDTPWPKLLKARAALAE
FT                   RLAEPHPQALLELLADAAPAADSQLPDTGVGLATERLLSSVFIASPSYGTRASSVVRVH
FT                   ADGTREMIERSFGPSGARLGEVSLVLPPG"
FT   gene            397086..397889
FT                   /locus_tag="PA14_04440"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0340"
FT   CDS_pept        397086..397889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04440"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15304"
FT                   /db_xref="GOA:A0A0H2ZKR3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR3"
FT                   /protein_id="ABJ15304.1"
FT                   /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGDV
FT                   LTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIKGL
FT                   LLQKIIGVFAILVALQMVLDLKPKGSREVPGKGGLTLAGAVIGWASAIFGIGGGSLTVP
FT                   FLSWRSVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALVGIAA
FT                   TSMLFARFGARLAHRLSPRVLKRLFALLLFSVGISFLTPDLAFLS"
FT   gene            397899..398699
FT                   /gene="lgt"
FT                   /locus_tag="PA14_04460"
FT   CDS_pept        397899..398699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="PA14_04460"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15305"
FT                   /db_xref="GOA:Q02U74"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U74"
FT                   /protein_id="ABJ15305.1"
FT                   /translation="MLTYPQIDPVALAVGPLKIHWYGLMYLIGIGGAWLLASRRMKRFD
FT                   PTWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGLLG
FT                   VMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMVFPN
FT                   GGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEFVRVP
FT                   DAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA"
FT   gene            398905..399699
FT                   /gene="thyA"
FT                   /locus_tag="PA14_04480"
FT   CDS_pept        398905..399699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="PA14_04480"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15306"
FT                   /db_xref="GOA:Q02U73"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U73"
FT                   /protein_id="ABJ15306.1"
FT                   /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLV
FT                   TTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAP
FT                   DGRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQL
FT                   YQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTR
FT                   EPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV"
FT   gene            complement(399726..400523)
FT                   /locus_tag="PA14_04490"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0343"
FT   CDS_pept        complement(399726..400523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15307"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL35"
FT                   /protein_id="ABJ15307.1"
FT                   /translation="MPFVSYAQNLEDVRLWRALKLFPRGFYIDVGANHPRIDSVTLAFY
FT                   ERGWRGINIEPLPHLHRELERERPEDLNLNLAIGEREGRATLYEMAASGLSTLDPELAR
FT                   QRQAEGCTATPREVMVSTLDAICAAHVEGPIHFLKIDVEGLEGAVLRGLDLNRWRPWLI
FT                   LAETPFDHDPEWKAPLLAAGYRFVHFDGLNGYYLAEEQARLEGAFALPPNLLDDFQLCH
FT                   GHAMSHPVAPLEQALEQALQRAEDAERALRDWRALPWYRRLFG"
FT   gene            complement(400558..401937)
FT                   /locus_tag="PA14_04510"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0344"
FT   CDS_pept        complement(400558..401937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15308"
FT                   /db_xref="GOA:A0A0H2ZKE6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE6"
FT                   /protein_id="ABJ15308.1"
FT                   /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGRFE
FT                   QEAKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPQHREEE
FT                   WRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHETQAAARL
FT                   RAGQRLIAELLVDVAACRRLVPGGESAVQEATRDLHQQVRKREQACVEALLRLYAFARD
FT                   DARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVTLGAAAA
FT                   LGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQTRGHAAIE
FT                   AIRLETPEDKQWREGKLPEALRKARAHPEWSSLNGRRVGGSDRQEQIDALAELLESGRG
FT                   E"
FT   gene            complement(401930..403315)
FT                   /locus_tag="PA14_04520"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0345"
FT   CDS_pept        complement(401930..403315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15309"
FT                   /db_xref="GOA:A0A0H2ZJZ2"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ2"
FT                   /protein_id="ABJ15309.1"
FT                   /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEALRQALAQGGSLP
FT                   RRILTRAHWLGRREGLLDAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPVNV
FT                   FWALASLLGLHLLTLLGWALGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPALLVL
FT                   LGRRRLARWGLGALVHGLWLLGLLTALAMLLGLLATRRYGFVWETTILGSDTFIALTQA
FT                   LGALPALLGFPLPDAELIRASGDAALASEAARHAWAGWLVGVLLVYGVLPRALLGLFCL
FT                   WRWKRGLADLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSGQEAAGAV
FT                   LVAVELDDRRPWPPKLAEGVADAGILDDGQQRRRLLDQLTRYPPARLAIACDPRRSPDR
FT                   GTLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHTALERLQLPHGETSPLAWLET
FT                   GHD"
FT   gene            403507..403869
FT                   /locus_tag="PA14_04530"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0346"
FT   CDS_pept        403507..403869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX5"
FT                   /protein_id="ABJ15310.1"
FT                   /translation="MKVVRRYPLALLLGMAGALADELPDGSLLQRYGVQADQLPTLAAD
FT                   PPSRKEEKETPSRFRVEPEQPLVTFGVKDHKGVEPTGNLSIDAMHERDRRICRNIRRQA
FT                   LEKGKAQPFDGYIECP"
FT   gene            complement(403906..405057)
FT                   /gene="glpQ"
FT                   /locus_tag="PA14_04550"
FT   CDS_pept        complement(403906..405057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="PA14_04550"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15311"
FT                   /db_xref="GOA:A0A0H2ZKR6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR6"
FT                   /protein_id="ABJ15311.1"
FT                   /translation="MQPAFLRRHLGAACLMLAAGLASAAHADTGNVQRAIDWAQGQASV
FT                   RHPAGHERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYVEPDLVMTRDGKLVARHDN
FT                   ELGLTTDVAQHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIRPGNAR
FT                   LDGTFEIPTLQEIIDLVKSLQISQQRTIGLYPEIKHGTHFQRLGLAMERPLVKTLHRNG
FT                   YLGPRAPVFIQSFEVNNLKELKRLTGIRLVQLYGSGQPYDQQASGGSLTYAEMATAKGL
FT                   RQVARYAYGVGPDKSYVIPRDANGNLGQPTRFVGDAHAAGLKVHPYTFRAENSFLPAEF
FT                   RSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
FT   gene            405267..406361
FT                   /locus_tag="PA14_04560"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0348"
FT   CDS_pept        405267..406361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL38"
FT                   /protein_id="ABJ15312.1"
FT                   /translation="MASAQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARVEA
FT                   RVPTAATDDWGRQPDSLMSAVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGFFI
FT                   QRMLIRMEPTRPGAPLSLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVRNLR
FT                   MSTRKDGQEVRGELLRKGRWRPLRMLTEIELSGPLEVTLVPRRIFVDGVEVTSSLAAAS
FT                   IEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGMQLALGDSLADL
FT                   QWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPGQPLLFNLYDYRRQLQNGVIR
FT                   LREDGMVQIAVSPVKAPAPLEARL"
FT   gene            406358..407398
FT                   /locus_tag="PA14_04570"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0349"
FT   CDS_pept        406358..407398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE9"
FT                   /protein_id="ABJ15313.1"
FT                   /translation="MSRRPWGVLLGWCLLAASAVQAESAIDRQQRELALLREGWYRQVP
FT                   PAPVPLPMRTAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVDFD
FT                   RPQDIHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVRPLG
FT                   VGPWLPLRLGGGVEVDAASGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLDRPGAS
FT                   LVGSAMRLDYRKVFPLLGIDGHVQEAWLDDQGLHLRFSQAPGQPSPVFSPPAAAGPSFL
FT                   WLQSGDLKIFEILITYAQVLLKTETPDQVLTFNLQDYRKVLATGTTQVNEDGTFFMQVP
FT                   PYANPL"
FT   gene            407469..407975
FT                   /gene="folA"
FT                   /locus_tag="PA14_04580"
FT   CDS_pept        407469..407975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="PA14_04580"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15314"
FT                   /db_xref="GOA:A0A0H2ZJZ7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ7"
FT                   /protein_id="ABJ15314.1"
FT                   /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIM
FT                   GRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLI
FT                   GGAQLYAEALPRAARLYLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFE
FT                   VWERR"
FT   gene            complement(407991..408464)
FT                   /locus_tag="PA14_04590"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0351"
FT   CDS_pept        complement(407991..408464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04590"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15315"
FT                   /db_xref="GOA:A0A0H2ZKX9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX9"
FT                   /protein_id="ABJ15315.1"
FT                   /translation="MPQSRRPLRIGLIADTHGLLRPEALERLRGCDQLIHAGDIGKPEI
FT                   LAELERLAPLSVVRGNNDTQDWAADIPERLLLKIGRLTLYVLHDLKRLDLDPAAEGIDV
FT                   VVAGHSHKPLKEERDGVLYLNPGSAGPRRFSLPIGIGVLEVAGKKIEAELITL"
FT   gene            complement(408603..409988)
FT                   /gene="yicE"
FT                   /locus_tag="PA14_04610"
FT   CDS_pept        complement(408603..409988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="PA14_04610"
FT                   /product="putative xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15316"
FT                   /db_xref="GOA:A0A0H2ZKR9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR9"
FT                   /protein_id="ABJ15316.1"
FT                   /translation="MSSLQSPSDASARNDLVYGLDDRPSAPIALLAALQHLLAIIVPIV
FT                   TPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGP
FT                   LIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVVLMI
FT                   GLTLIKVGLISMGGGFSAMSNGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCAIVIA
FT                   LAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSLEAIGD
FT                   VTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVIQLTGVA
FT                   SRYVGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINILAGIQLDR
FT                   RALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWFLPESPVQK
FT                   AGH"
FT   gene            complement(410218..412056)
FT                   /gene="ilvD"
FT                   /locus_tag="PA14_04630"
FT   CDS_pept        complement(410218..412056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="PA14_04630"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15317"
FT                   /db_xref="GOA:Q02U62"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U62"
FT                   /protein_id="ABJ15317.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLAT
FT                   HADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIANFKAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEAEVPFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGELARG
FT                   GLLHTDVPTVHSPSMADAIAQWDITQTRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLD
FT                   DDRAEGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGSAKIFESQDA
FT                   AVKGILGDEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVQDGDKVLIDIPNRSINLLVSDEELAARRAEQDKKGWK
FT                   PAAPRARRVSTALKAYALLATSADKGAVRNKALLDG"
FT   gene            complement(412384..413580)
FT                   /locus_tag="PA14_04640"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0354"
FT   CDS_pept        complement(412384..413580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04640"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15318"
FT                   /db_xref="GOA:A0A0H2ZL43"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL43"
FT                   /protein_id="ABJ15318.1"
FT                   /translation="MTLPSLRLKANAERRLRAGHLWVYSNEVDVAATPLNAFAAGDQAV
FT                   LEMANGKPLGIVALSPNNLICGRLISRDTKHVLDKSLLVHRINIALSLRERLFDKPFYR
FT                   LVYGDSDLLPGLVVDRFGDVLVVQLASAAMELRKDEVLAALLQVLKPAAVLWKNDSSAR
FT                   DAEGLERYVANAYGEVPEWVALEENGVKFEAPVLAGQKTGWFYDHRMNRARLAPYVQGK
FT                   RVLDLFSYIGGWGIQAAAFGASEVMCVDASAFALDGVERNAALNGVAEKVACVEGDVFE
FT                   ALRELKAADERFDVVIADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLSKDGILVSASCS
FT                   MHLPEDDLQNILIGSARHLDRNIQLLERGGQGPDHPVHLAIAETRYIKSLTCRLLPNG"
FT   gene            complement(413653..414192)
FT                   /gene="pfpI"
FT                   /locus_tag="PA14_04650"
FT   CDS_pept        complement(413653..414192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="PA14_04650"
FT                   /product="protease PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15319"
FT                   /db_xref="GOA:A0A0H2ZKF3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF3"
FT                   /protein_id="ABJ15319.1"
FT                   /translation="MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSAKAG
FT                   EVRGWNHHQPADAFRVDGTFEDASLDDYDALLLPGGVINSDQIRSLAKAQELAIRAEQA
FT                   SKPVAVICHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSSRKP
FT                   EDIPAFNRRFIEILAG"
FT   gene            414409..415233
FT                   /locus_tag="PA14_04660"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0356"
FT   CDS_pept        414409..415233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04660"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15320"
FT                   /db_xref="GOA:A0A0H2ZK04"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK04"
FT                   /protein_id="ABJ15320.1"
FT                   /translation="MPPQPQIMVDLQMEQVMPNPDLKNIARLISQDPGLSGALLKLVNS
FT                   PFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSDDTIVTLNRFWDTAQDVAMSC
FT                   LSLAKRVGYESVDEAYALGLFHNCGIPLMLKRFPHYMAVLEEAYAAASDKRRVVDTENR
FT                   VLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIFGDESARDTQLKNLLAILKMAEH
FT                   ICGSHRILGNQPEDHEWNSIGALVLDYVGLTDYDFENLKGSILELGVGQGSY"
FT   gene            415292..416104
FT                   /gene="mutM"
FT                   /locus_tag="PA14_04670"
FT   CDS_pept        415292..416104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PA14_04670"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15321"
FT                   /db_xref="GOA:Q02U58"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U58"
FT                   /protein_id="ABJ15321.1"
FT                   /translation="MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRL
FT                   SGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMAL
FT                   RYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNA
FT                   VVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFV
FT                   GGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR"
FT   gene            416181..416759
FT                   /locus_tag="PA14_04680"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0358"
FT   CDS_pept        416181..416759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04680"
FT                   /product="putative phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15322"
FT                   /db_xref="GOA:A0A0H2ZKY5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY5"
FT                   /protein_id="ABJ15322.1"
FT                   /translation="MSGNYLPRNTLVESLGHAMLKLSGWKIEGQLPALDKFVVIGAHHT
FT                   SNWDFVAFLAAKFVLRLNARWFGKHTLFKGPLGGLMRRWGGIPIQRHLKLNTVDQAIQA
FT                   FREHREFMLIIAPEGTRKKVDRWRMGFYHIARGAGVPVVPAALDYENRRIVIGEPFWPT
FT                   GNEDADLCSLIGFYRPFIPKKPHYAFLGD"
FT   gene            416842..417186
FT                   /locus_tag="PA14_04690"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0359"
FT   CDS_pept        416842..417186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15323"
FT                   /db_xref="GOA:A0A0H2ZKS3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS3"
FT                   /protein_id="ABJ15323.1"
FT                   /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAY
FT                   AMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGC
FT                   TTSGYNHDES"
FT   gene            417456..418442
FT                   /locus_tag="PA14_04700"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0360"
FT   CDS_pept        417456..418442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15324"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL48"
FT                   /protein_id="ABJ15324.1"
FT                   /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAKEQSKAEQGDKRGDEL
FT                   FAEFTRLRQAAETGEPQALFDFGAYFYQQQNYASAREWWGKAAAAGMVRAQIQLAMLYR
FT                   DGDGGPQDKTEAARWFRKAAEQGDAAAQNEMGVLYWRGEGVDQDRVKAGTWFERAAASG
FT                   SEDAETNLGWFYLDDSQGVYSATSDEEAALLDRYAGSREKAFQWFCKAATQGDARAQFK
FT                   VGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESAANAAWYTRLENWIHAALDG
FT                   ELSGVADCSGVADRRHSGRGMEGASSEPEAVEASAEDAQQAAEAASQ"
FT   gene            complement(418555..418986)
FT                   /locus_tag="PA14_04710"
FT   CDS_pept        complement(418555..418986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF6"
FT                   /protein_id="ABJ15325.1"
FT                   /translation="MSLFRPLLIASTLALASGCASGLNSQQTAELEYYEARNLAVIEKS
FT                   PGTGAALGLLPGGGSFYGRSYGLGVVNLLFWPLSILWDPVSGYDASQRINYTATRVHLE
FT                   KLRQRDFDELQRLADNGALDGATLARKRQDVETKYRYTP"
FT   gene            complement(419138..420871)
FT                   /locus_tag="PA14_04730"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0361"
FT   CDS_pept        complement(419138..420871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04730"
FT                   /product="probable gamma-glutamyltranspeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15326"
FT                   /db_xref="GOA:A0A0H2ZK10"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK10"
FT                   /protein_id="ABJ15326.1"
FT                   /translation="MSFLNLPVRTLVAACGLSLLSLAAHADSFRGDAHAPQQAAVATPH
FT                   PAATVAGLETLANGGNAFDAAAAIAAALAVAEPYGSGLGGGGFFLLRQAGAQPTYRFLD
FT                   ARERAPKAAYADMYRRNGKVDPRLSVDGPLAAAIPGLPAALVELSGRYGRKPLADNLVP
FT                   AIRLAVDGVSVDRVYRDRVAMRLEAMRKDPETARIFLDKGGIPDEWNLLRQPQLARTLE
FT                   RLGRYGRIGFYEGETADKLLTGVRAGGGIWSAADLRDYRVIERRPLEVKLANGRELISA
FT                   PPPSAGGVALAQSLQMLEQLPWQKAEPVQRAHYVLEVLRRAYRDRGLLGDPDFVANPLP
FT                   SLLAPDYLKRLAAGIDPRRATPSSALPEAPAWREGDHTTHFAVIDAQGNAVAATLSVNL
FT                   PFGAAFTVPGTGVVLNNEMDDFAADTQGANSYGLAGSQANAVAAGKRPLSSMSPSFLES
FT                   PTDFAAFGTPGGSRIPSMVLISMLQYFDGRPVGQWVAAPRYHHQYKPDVVEYEPRAFSD
FT                   AEAAELRRRGYQLKRLERSYGNQQVLYWDKRSGRVDAASDPRGIGYSAFSPEMQAQPQA
FT                   H"
FT   gene            complement(420999..421250)
FT                   /gene="fdx1"
FT                   /locus_tag="PA14_04750"
FT   CDS_pept        complement(420999..421250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx1"
FT                   /locus_tag="PA14_04750"
FT                   /product="ferredoxin (4Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15327"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ1"
FT                   /protein_id="ABJ15327.1"
FT                   /translation="MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHY
FT                   DEPQCQQVCPVDCIPLDDANVESKDQLMEKYRKITGKA"
FT   gene            complement(421371..421850)
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="PA14_04760"
FT   CDS_pept        complement(421371..421850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="PA14_04760"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15328"
FT                   /db_xref="GOA:Q02U51"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U51"
FT                   /protein_id="ABJ15328.1"
FT                   /translation="MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLF
FT                   SLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANM
FT                   NRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR"
FT   gene            complement(421999..423594)
FT                   /locus_tag="PA14_04780"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0364"
FT   CDS_pept        complement(421999..423594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04780"
FT                   /product="putative oxidoreductase, GMC family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04780"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15329"
FT                   /db_xref="GOA:A0A0H2ZKS7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS7"
FT                   /protein_id="ABJ15329.1"
FT                   /translation="MPVPDLFAEGLARGWKTYNGSRLDDDLELEADVVVVGTGAGGGTT
FT                   AEILSAAGLKVLLVEEGPLKTSSDFKMQEADAYPELYQEGIGRMSKDGAITILQGRAVG
FT                   GTTLINWTSSFRTPEPTLQHWAQVYGVKGHSAEDMAPWFEKMEQRLHVAPWALPPNANN
FT                   DVIRLGCEKLGYHWKVIPRNVLGCWNLGYCGMGCPVNAKQSMLVTTIPATLDKGGELLY
FT                   LARANRLLLDGDKVTGLECLGMDERCVAPNGRRIRVRARHYVLSGGGINTPAILLRSKA
FT                   PDPSQRVGKRTFLHTVNFSAGLFDRVINPFYGAPQSIYSDHFQWDDGVTGRMSYKLEVP
FT                   PLQPSLASVLLGGFGSDNALRMEQLPHTNMMLALLRDGFHPDSAEGSVGLRGDDTPVLD
FT                   YRMTDYTWDGIRRAFHTMAEIQFAAGAREVRPVHSDARSAKNLQEARGIIDGLRLEIYR
FT                   TRLGSAHVMGGCAMGEDPAVAVADSLGRHHHLRNLSIHDGSLFPTSIGANPQLSVYGLT
FT                   AQLASALAERLARA"
FT   gene            complement(423650..424198)
FT                   /locus_tag="PA14_04790"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0365"
FT   CDS_pept        complement(423650..424198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15330"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL54"
FT                   /protein_id="ABJ15330.1"
FT                   /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVTASLTGCSAEKPA
FT                   SGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLTQQ
FT                   LFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAMMAW
FT                   YARPEAWAHCGYPGPPKIA"
FT   gene            complement(424253..425683)
FT                   /locus_tag="PA14_04810"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0366"
FT   CDS_pept        complement(424253..425683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04810"
FT                   /product="putative NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15331"
FT                   /db_xref="GOA:A0A0H2ZKG0"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG0"
FT                   /protein_id="ABJ15331.1"
FT                   /translation="MVADIAYLQQSQQEINQLEALFARQRAAYLAQPMPDATQRVQWLK
FT                   ALRELLFKEQQALIEAIDRDFSARSADETLLAEIMPSLHGIHYAAKRVKKWMKPARRAV
FT                   GLQFQPASAQVVYQPLGVVGVIVPWNYPLFLSIGPLTGALAAGNRVMIKMSESTPATGR
FT                   LLKDLLARIFPEDQVAVVLGEVDVGVAFSKLPFDHLLFTGATSVGKHVMRAAAENLTPV
FT                   TLELGGKSPAIISDSVPMKDAAERIAFGKSLNAGQTCVAPDYVLVPSRRVEEFVSQYKE
FT                   VVQGFFPRLSDNPDYTAIINERQLGRLRGYLDDAREKGATLVPLFAEGQQRRLPQTLLL
FT                   NVSDDMKVMQEEIFGPLLPVIPYERLEDALAYVNQRPRPLALYYFGYDKAQQQRVLHET
FT                   HSGGVCLNDTLLHVAQDDIPFGGVGPSGMGHYHGHEGFLTFSKAKGVFSKPRFNAARMI
FT                   YPPYGKSIQKLVYKLFVR"
FT   gene            425972..426619
FT                   /locus_tag="PA14_04820"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0367"
FT   CDS_pept        425972..426619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04820"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15332"
FT                   /db_xref="GOA:A0A0H2ZK17"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK17"
FT                   /protein_id="ABJ15332.1"
FT                   /translation="MAPRIKTRDRIAQASLELFNAQGERSVTTNHIATHLGISPGNLYY
FT                   HYPNKQAIIAELFAEYESHVESFLRLPEGRGLTVDDKTFYLEALLAAMWRYRFLHRDLE
FT                   HLLESDPELAARYRAFAQRCLVNAKAIYRGFTEAGILRMNETQLEALTLNAWIILTSWV
FT                   RFLCTTLDLDGDLSEAQLRRGIYQVLALESGHIEAQAQDAVDGISERLYVPL"
FT   gene            complement(426604..427014)
FT                   /locus_tag="PA14_04830"
FT   CDS_pept        complement(426604..427014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04830"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15333"
FT                   /db_xref="GOA:A0A0H2ZKZ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ6"
FT                   /protein_id="ABJ15333.1"
FT                   /translation="MELTLRHNPMLDDADCEAILAIHAAVGWDRRMPPAELRTLYQHSG
FT                   YSLLAERDGRLVGLLRAEEETPIRVWLAEIAVLPGAQRSGVGAALLRRFAEDHRGAYLF
FT                   TDATLGTEAFFRRHGIHIQQVLEKTLRDQSGT"
FT   gene            complement(427077..428075)
FT                   /locus_tag="PA14_04840"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0368"
FT   CDS_pept        complement(427077..428075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04840"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15334"
FT                   /db_xref="GOA:A0A0H2ZKT1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT1"
FT                   /protein_id="ABJ15334.1"
FT                   /translation="MTASPTFQPAWWLPNPHLQTLWSPFFRRGPTLERQRERLWLADGD
FT                   FIDLDWAGPHDAETPLVLALHGLTGSSSSHYILGLQRALLERGWASVALNWRGCSGEPN
FT                   RLPRGYHSGVSDDLAEVVAHLRARRPQAPLYAVGYSLGGNVLLKYLGETAGDCPLLGGV
FT                   AVSVPFRLDECADRIGLGFSRVYQAHFMKAMLAYVQDKQRLFGEQGQAEGLAALQRLGP
FT                   LEGMRTFWDFDGRVTAPLHGFADARDYYRRASSRYYLPDIRTPSLIIHSSDDPFVFARS
FT                   LPDRSELAPCTELELHARGGHVGFVDGSPRQPTYYLERRIPDWLEARLRQH"
FT   gene            complement(428112..428402)
FT                   /locus_tag="PA14_04850"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0369"
FT   CDS_pept        complement(428112..428402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL59"
FT                   /protein_id="ABJ15335.1"
FT                   /translation="MADQGADPFILETGSGRILFDLHGGRGWDPAPCFDDLWQMAASLA
FT                   CFGEVWSGAGEDILLDDCSVAPRYRQQLVDELQPILGSRQRAEDLADEFGW"
FT   gene            complement(428681..429277)
FT                   /gene="yhhF"
FT                   /locus_tag="PA14_04860"
FT   CDS_pept        complement(428681..429277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhF"
FT                   /locus_tag="PA14_04860"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15336"
FT                   /db_xref="GOA:A0A0H2ZKG3"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG3"
FT                   /protein_id="ABJ15336.1"
FT                   /translation="MSKPTAKAPGRHGGQGQLRIIGGEWRSRRFVFPDGPGLRPTPDRV
FT                   RETLFNWLAPYVEGARVLDPFAGSGALFLEALSRGAREGLALDTNGEAVAALRNHLDAL
FT                   KCGTAQLVLGDAVRYLGNQAPSAFDLVFLDPPFHQNLLQDACRLLETRGWLNPDAWIYT
FT                   ESESVPSSLGLPGNWRLHREKKAGNVHYALWQRGA"
FT   gene            complement(429277..430764)
FT                   /locus_tag="PA14_04870"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0371"
FT   CDS_pept        complement(429277..430764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04870"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15337"
FT                   /db_xref="GOA:A0A0H2ZK22"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK22"
FT                   /protein_id="ABJ15337.1"
FT                   /translation="MSERTGLRYGLLGLIVIALLAALAYFVARPPQTPAAAHAAAVEEN
FT                   QLQSLKDVAKQAPVHRKLDIQEWKTAEGAKVLFVEAHELPMFDLRLTFAAGSSQDAGTP
FT                   GLSMLTNAMLNEGVPGKDTTAIAAGFEDLGASFSNGSYRDMAVAGLRSLSDADKRTQAL
FT                   KLFEQVIGQPTFPEDALARIKNQVLAGFEYQKQNPGKLAGLELFKRLYGEHPYAHSSDG
FT                   DEKSVPPISREQLQAFHKKAYAAGNVVIALVGDLSRQEAEAIAAEVSKALPQGPALAKT
FT                   AQPETPKPGLTHIDFPSEQTHLMLAQLGIDRQDPDYAALYLGNQILGGGGFGTRLMDQV
FT                   REKRGLTYGIYSGFTAMQARGPFMINFQTRAELSEGALKLVQDIVRDYLANGPTQKELD
FT                   DAKRELAGSFPLSTASNADIVGQLGAIGFYGLPLDYLESFLKQVEGLSVEQVRTAMAKH
FT                   LDADAFVIVSAGPSVPQKPLPPPTAKPAQQPSGVPEH"
FT   gene            complement(430757..432154)
FT                   /locus_tag="PA14_04890"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0372"
FT   CDS_pept        complement(430757..432154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04890"
FT                   /product="putative zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15338"
FT                   /db_xref="GOA:A0A0H2ZL01"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL01"
FT                   /protein_id="ABJ15338.1"
FT                   /translation="MAARKVQITMKTPARRRVGLLLASLCLPLFAQAAETQPTHEFSLD
FT                   NGLKVIVREDHRAPVVVSQLWYRIGSSYETPGLTGLSHALEHMMFKGSRKLGPGEASRV
FT                   LRDLGAEENAFTTDDYTAYYQVLARDRLPVALEMEADRMAHLSLPADQFKSEIEVIKEE
FT                   RRLRTDDNPNALAFERFKAAAYPASGYHTPTIGWMADLQRMTIDDLRHWYESWYAPNNA
FT                   TLVVVGDVTADEVKTLAKRYFGEIPWRQLPPARKPLELAEPGERRLKLYVRTQLPNLIM
FT                   GFNVPSLGSSENPREVNALRLIGALLDGGYSARLASRLERGEELVAGASTYYDAFNRGD
FT                   SLFVLSATPNVQKGKTLEQVEAGLWKQLDDLKQNPPSAAEIERVRAQMIAGMVYEKDSI
FT                   AAQASSIGQLESVGLSWKLIDQDLEALKAVTPDDIQKAARTYFTPSRLTLAQVLPVKAE
FT                   EKEARHE"
FT   gene            432275..433630
FT                   /gene="ftsY"
FT                   /locus_tag="PA14_04900"
FT   CDS_pept        432275..433630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PA14_04900"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15339"
FT                   /db_xref="GOA:A0A0H2ZKT5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT5"
FT                   /protein_id="ABJ15339.1"
FT                   /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSETA
FT                   AAEQRAPADDVAQSLTEQPGRQQPSAAEPAEPPAPVAEAPLAGDEPASAEEHSPRPEAP
FT                   VAQPEPILAAEPEPEPEPEPEPVAPLAAAPAVSEPATRPGFFARLRQGLSKTSASIGEG
FT                   MASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKAL
FT                   QEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAG
FT                   DTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLH
FT                   TKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTK
FT                   LDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
FT   gene            433627..434298
FT                   /gene="ftsE"
FT                   /locus_tag="PA14_04910"
FT   CDS_pept        433627..434298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PA14_04910"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15340"
FT                   /db_xref="GOA:A0A0H2ZL67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL67"
FT                   /protein_id="ABJ15340.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTLL
FT                   RLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVADNIALPL
FT                   QILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIADREDE
FT                   A"
FT   gene            434298..435305
FT                   /gene="ftsX"
FT                   /locus_tag="PA14_04920"
FT   CDS_pept        434298..435305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PA14_04920"
FT                   /product="cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15341"
FT                   /db_xref="GOA:A0A0H2ZKG8"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG8"
FT                   /protein_id="ABJ15341.1"
FT                   /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFSAYLESHRASL
FT                   VDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDLKT
FT                   SENQGQDLREQIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVISVTP
FT                   KQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLTLLLV
FT                   VGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAYSLNWL
FT                   NGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAPR"
FT   gene            435419..436273
FT                   /gene="rpoH"
FT                   /gene_synonym="htpR"
FT                   /locus_tag="PA14_04930"
FT   CDS_pept        435419..436273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /gene_synonym="htpR"
FT                   /locus_tag="PA14_04930"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15342"
FT                   /db_xref="GOA:A0A0H2ZK26"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK26"
FT                   /protein_id="ABJ15342.1"
FT                   /translation="MTTSLQPVHALVPGANLEAYVHSVNSIPLLSPEQERELAERLFYQ
FT                   QDLEAARQMVLAHLRFVVHIAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNEEVHRVAESLG
FT                   VEPREVREMESRLTGQDMAFDPAADADDESAYQSPAHYLEDHRYDPARQLEDADWSDSS
FT                   SANLHEALEGLDERSRDILQQRWLSEEKATLHDLAEKYNVSAERIRQLEKNAMSKLKGR
FT                   ILA"
FT   gene            436338..436943
FT                   /locus_tag="PA14_04940"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0377"
FT   CDS_pept        436338..436943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15343"
FT                   /db_xref="GOA:A0A0H2ZL06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL06"
FT                   /protein_id="ABJ15343.1"
FT                   /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWQEQVL
FT                   APLADNALTLRQLHDAVDGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEEQL
FT                   SLQRASALQPGSAPQPLSAGLEGQLGDKPIVALSMIPEGRVGAERLLASLGQPRLRLQL
FT                   AQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPPR"
FT   gene            complement(436948..437679)
FT                   /gene="mtgA"
FT                   /locus_tag="PA14_04950"
FT   CDS_pept        complement(436948..437679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="PA14_04950"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15344"
FT                   /db_xref="GOA:A0A0H2ZKT9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT9"
FT                   /protein_id="ABJ15344.1"
FT                   /translation="MAAPFFQAKPRMLRSLFRRLFKYLLWFMAASVVLVAVLRWVPPPG
FT                   TMVMVERKVGSWVDGQPIDLQRDWRSWEQLPDSLKVAVIAGEDQHFAEHHGFDLPAIQQ
FT                   ALAHNERGGSIRGASTLSQQVAKNVFLWSGRSWLRKGLEAWFTLLIETLWTKQRILEVY
FT                   LNSAEWGPGVFGAQAAARYHFGLDAERLSRTQASQLAAVLPSPLKWSAARPGPYVRQRA
FT                   AWIRQQMWQLGGDDYLLRLER"
FT   gene            437716..438093
FT                   /locus_tag="PA14_04960"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0379"
FT   CDS_pept        437716..438093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04960"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15345"
FT                   /db_xref="GOA:A0A0H2ZL73"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL73"
FT                   /protein_id="ABJ15345.1"
FT                   /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEYLAVFQTGVHY
FT                   QLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIVTPFG
FT                   GVSFLAGWLCLGLAAWRLGNA"
FT   gene            438196..438396
FT                   /gene="thiS"
FT                   /locus_tag="PA14_04970"
FT   CDS_pept        438196..438396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PA14_04970"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15346"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH0"
FT                   /protein_id="ABJ15346.1"
FT                   /translation="MQIQLNGEPFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQ
FT                   HASTALKDGDRVEIVHAIGGG"
FT   gene            438455..439252
FT                   /gene="thiG"
FT                   /locus_tag="PA14_04980"
FT   CDS_pept        438455..439252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PA14_04980"
FT                   /product="thiamine biosynthesis protein, thiazole moiety"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15347"
FT                   /db_xref="GOA:Q02U32"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U32"
FT                   /protein_id="ABJ15347.1"
FT                   /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAE
FT                   IVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHN
FT                   LVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPL
FT                   AGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHA
FT                   KDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
FT   gene            439406..440077
FT                   /gene="micA"
FT                   /gene_synonym="yggH"
FT                   /locus_tag="PA14_05000"
FT   CDS_pept        439406..440077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="micA"
FT                   /gene_synonym="yggH"
FT                   /locus_tag="PA14_05000"
FT                   /product="DNA mismatch repair protein MicA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15348"
FT                   /db_xref="GOA:Q02U31"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U31"
FT                   /protein_id="ABJ15348.1"
FT                   /translation="MRTVKSFVMRAGRMTEGQQRGLDLGWPKFGLELSDEVQDFDAIFG
FT                   RQAPRTFEIGFGMGHSTLEMAAAAPDIDFIGVEVHKPGVGALLNGLLTQGLGNVRVYSC
FT                   DALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVGGVLHMAT
FT                   DWEPYAEHMLDVMSAAPGYRNQAEDGRFVARPQERPVTKFERRGERLGHGVWDLKFERI
FT                   D"
FT   gene            440240..441586
FT                   /locus_tag="PA14_05010"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0383"
FT   CDS_pept        440240..441586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15349"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK31"
FT                   /protein_id="ABJ15349.1"
FT                   /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGNA
FT                   DGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVVDSRNMAAYQALLTPGTQALLQA
FT                   NPDYHLRVFPSRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSGQEA
FT                   IWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTLFYYK
FT                   YKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDTNGMAT
FT                   ADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDLLRYELH
FT                   RVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPINYYDVPL
FT                   VSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
FT   gene            complement(441599..441856)
FT                   /locus_tag="PA14_05020"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0384"
FT   CDS_pept        complement(441599..441856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL11"
FT                   /protein_id="ABJ15350.1"
FT                   /translation="MKPIKHLYLHFTDGQRLSLRFPRQQDDPAEVARSIRQQLDTPYLS
FT                   VEVDGDLLLIPRDSIKYLQISPAPARLDDDGTLRGAELIV"
FT   gene            complement(441918..442241)
FT                   /locus_tag="PA14_05030"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0385"
FT   CDS_pept        complement(441918..442241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15351"
FT                   /db_xref="GOA:A0A0H2ZKU4"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU4"
FT                   /protein_id="ABJ15351.1"
FT                   /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQR
FT                   IGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGMIA
FT                   DRS"
FT   gene            complement(442322..443476)
FT                   /locus_tag="PA14_05040"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0386"
FT   CDS_pept        complement(442322..443476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05040"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15352"
FT                   /db_xref="GOA:A0A0H2ZL77"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL77"
FT                   /protein_id="ABJ15352.1"
FT                   /translation="MTQATPFQLPPLALYVHIPWCVRKCPYCDFNSHAAGTELPEEAYV
FT                   DALLADLEQDLRHVHGRRLGSIFFGGGTPSLFSAKALGRLLEGVERRVGFADGIEITLE
FT                   ANPGTFEQVKFADYRRLGINRLSIGVQSFQADKLQALGRIHDGAEAVRAADMARQAGFD
FT                   NFNLDLMHGLPGQSLDDALADLRQALALAPTHLSWYQLTMEPNTVFWSQPPELPEDDIL
FT                   WDIQEAGQALLDAHGYRQYETSAYARDDLRARHNLNYWSFGDFLGIGAGAHAKLSAPDG
FT                   RIVRTWKTRLPKDYLNPQKAFQAGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQ
FT                   PLAAIADACAAARDAGLLADDPQRLRPSERGQLFLNDLLQHFLP"
FT   gene            complement(443597..444190)
FT                   /locus_tag="PA14_05050"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0387"
FT   CDS_pept        complement(443597..444190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05050"
FT                   /product="putative Ham1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15353"
FT                   /db_xref="GOA:A0A0H2ZKH4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH4"
FT                   /protein_id="ABJ15353.1"
FT                   /translation="MIKLEQLVLASHNAGKLKELQAMLGASVKVRSIGEFSQVEPEETG
FT                   LSFVENAILKARNAARLSGLPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLL
FT                   EAMKDVPDAERGAQFVSVLALVRHADDPLPILCEGIWEGRILREARGAHGFGYDPLFWV
FT                   PERDCSSAELAPEEKNRLSHRARAMALLKQRLGL"
FT   gene            complement(444187..444606)
FT                   /locus_tag="PA14_05060"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0388"
FT   CDS_pept        complement(444187..444606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15354"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK38"
FT                   /protein_id="ABJ15354.1"
FT                   /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNVA
FT                   SAVGLVRSKAQGVINVVPMEKGKPVEASVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQ
FT                   FPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
FT   gene            complement(444738..445358)
FT                   /gene="metW"
FT                   /locus_tag="PA14_05070"
FT   CDS_pept        complement(444738..445358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="PA14_05070"
FT                   /product="putative methionine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15355"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL16"
FT                   /protein_id="ABJ15355.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLEI
FT                   DPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRVGK
FT                   TCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLRMRV
FT                   LDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRNLAV"
FT   gene            complement(445366..446505)
FT                   /gene="metX"
FT                   /locus_tag="PA14_05080"
FT   CDS_pept        complement(445366..446505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="PA14_05080"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15356"
FT                   /db_xref="GOA:Q02U23"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U23"
FT                   /protein_id="ABJ15356.1"
FT                   /translation="MPTVFPDDSVGLVSPQTLHFNEPLELTSGKSLAEYDLVIETYGEL
FT                   NATQSNAVLICHALSGHHHAAGYHSVDERKPGWWDSCIGPGKPIDTRKFFVVALNNLGG
FT                   CNGSSGPASINPATGKVYGADFPMVTVEDWVHSQARLADRLGIRQWAAVVGGSLGGMQA
FT                   LQWTISYPERVRHCLCIASAPKLSAQNIAFNEVARQAILSDPEFLGGYFQEQGVIPKRG
FT                   LKLARMVGHITYLSDDAMGAKFGRVLKTEKLNYDLHSVEFQVESYLRYQGEEFSTRFDA
FT                   NTYLLMTKALDYFDPAAAHGDDLVRTLEGVEADFCLMSFTTDWRFSPARSREIVDALIA
FT                   AKKNVSYLEIDAPQGHDAFLMPIPRYLQAFSGYMNRISV"
FT   gene            complement(446594..448561)
FT                   /locus_tag="PA14_05110"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0391"
FT   CDS_pept        complement(446594..448561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15357"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU7"
FT                   /protein_id="ABJ15357.1"
FT                   /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAKL
FT                   ERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFHDP
FT                   RAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTGDPEGMAQAFAQVAKTKALPV
FT                   EQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALGSEPE
FT                   LTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDVLWDDL
FT                   SGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRLDRLEAL
FT                   LCERIVAQKEALLENAVLGQVLGLLHNSQHLLRLRLEKVEEQRALLDDKQRDSGQLLFE
FT                   LTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRRNLNGSLTT
FT                   VGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDAPQLRVQRYQ
FT                   RELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLHQRLREETERWANDALM
FT                   PLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAEELQEQLREAGDILRQLR
FT                   RPSPLQRQAKVVNLPGSQRA"
FT   gene            complement(448669..448839)
FT                   /locus_tag="PA14_05120"
FT   CDS_pept        complement(448669..448839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15358"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL83"
FT                   /protein_id="ABJ15358.1"
FT                   /translation="MEGKANAHLLAFLGKAFGVAKSLVSLESGELNRQKRVRIRRPTRL
FT                   PEELGITARPA"
FT   gene            complement(448962..449555)
FT                   /locus_tag="PA14_05130"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0392"
FT   CDS_pept        complement(448962..449555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05130"
FT                   /product="putative YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15359"
FT                   /db_xref="GOA:A0A0H2ZKH5"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH5"
FT                   /protein_id="ABJ15359.1"
FT                   /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIV
FT                   RATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSI
FT                   IAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDL
FT                   SPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
FT   gene            complement(449566..450387)
FT                   /gene="proC"
FT                   /locus_tag="PA14_05150"
FT   CDS_pept        complement(449566..450387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="PA14_05150"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15360"
FT                   /db_xref="GOA:A0A0H2ZK42"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK42"
FT                   /protein_id="ABJ15360.1"
FT                   /translation="MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKI
FT                   AGEFAIDVVESNAEAVADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCAS
FT                   LEAWLGQPRPVVRCMPNTPALLRQGASGLYANAQVSAAQREQAGQLLSAVGIALWLDDE
FT                   AQIDAVTAVSGSGPAYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVE
FT                   PAELRRRVTSPNGTTEAAIKSFQANGFEALVEQALNAASQRSAELAEQLGQ"
FT   gene            complement(450399..451091)
FT                   /locus_tag="PA14_05160"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0394"
FT   CDS_pept        complement(450399..451091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05160"
FT                   /product="putative PLP dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15361"
FT                   /db_xref="GOA:A0A0H2ZL20"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL20"
FT                   /protein_id="ABJ15361.1"
FT                   /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVRE
FT                   AHAAGLRDFGENYLQEALGKQAELADLPLNWHFIGPIQSNKTRPIAEHFQWVHSVDRLK
FT                   IAQRLSEQRPAGLPLLNVCLQVNVSGEASKSGCAPEDLPALAEAVKQLPNLRLRGLMAI
FT                   PEPTAERAAQHAAFARLRELLLDLNLGLDTLSMGMSDDLEAAIGEGATWVRIGTALFGA
FT                   RDYGAPAS"
FT   gene            451306..452340
FT                   /gene="pilT"
FT                   /locus_tag="PA14_05180"
FT   CDS_pept        451306..452340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PA14_05180"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15362"
FT                   /db_xref="GOA:A0A0H2ZKV1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV1"
FT                   /protein_id="ABJ15362.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHK
FT                   QVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGRVAAHE
FT                   IMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKI
FT                   PENF"
FT   gene            452518..453666
FT                   /gene="pilU"
FT                   /locus_tag="PA14_05190"
FT   CDS_pept        452518..453666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="PA14_05190"
FT                   /product="twitching motility protein PilU"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15363"
FT                   /db_xref="GOA:A0A0H2ZL88"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL88"
FT                   /protein_id="ABJ15363.1"
FT                   /translation="MEFEKLLRLMVEKGGSDLFITAGVPPSMKVNGRVMPVTKTPLSPE
FT                   QTRETVLGVMNEQQRRDFAENHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETNIP
FT                   TLEELKLPEILKKLALTKRGLVIFVGATGTGKSTSLAAMIGYRNKNSTGHIISIEDPIE
FT                   YIHQHQGCIVTQREVGLDTDSFEVALKNTLRQAPDVIMIGEVRSRETMDHAVAFAETGH
FT                   LCLATLHANNANQALERIIHFFPADRHGQVWMDLSLNLKAIVAQQLVPTPDGKGRRAVI
FT                   EVLLNTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYQLYTQGEITYEDALAHAD
FT                   SANDLRLMIKLGSESDADHLSNLTQGLSLEITDDDPAGRRFR"
FT   gene            complement(453674..454573)
FT                   /gene="czcD"
FT                   /locus_tag="PA14_05200"
FT   CDS_pept        complement(453674..454573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="PA14_05200"
FT                   /product="putative cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15364"
FT                   /db_xref="GOA:A0A0H2ZKH9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH9"
FT                   /protein_id="ABJ15364.1"
FT                   /translation="MSAGHEHSFAQTNSTRLKWALLLTGSFLVAEVVGGILTGSLALIS
FT                   DAAHMLTDAVALAIALAAINIARRPTNDRLTYGYHRFEILAAAFNAFLLFGVAFYILYA
FT                   TYERLNQPAEIQSVGMLVIAVLGLLVNLASMRLLAPAQGNSLNVKGAYLEVWSDMLGSL
FT                   GVIVAAIVIRFTGWAWVDSLVAVLIGFWVLPRTWILLRESLHVLLEGVPKEIQLAELRE
FT                   ALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHS
FT                   TLQLETSACAQAEEPLAY"
FT   gene            454728..455132
FT                   /locus_tag="PA14_05210"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0398"
FT   CDS_pept        454728..455132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05210"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15365"
FT                   /db_xref="GOA:A0A0H2ZK47"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK47"
FT                   /protein_id="ABJ15365.1"
FT                   /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGLF
FT                   FIGWIIDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGVLGVHRMYMGKWITGIIYL
FT                   FTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
FT   gene            455375..456748
FT                   /locus_tag="PA14_05220"
FT   CDS_pept        455375..456748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05220"
FT                   /product="cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15366"
FT                   /db_xref="GOA:A0A0H2ZL24"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL24"
FT                   /protein_id="ABJ15366.1"
FT                   /translation="MTSDSRPAVLDLIGNTPLVRVTRFDTGPCTLFLKLESQNPGGSIK
FT                   DRIGVAMIEAAERDGRLRPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSTEKV
FT                   LHLRAMGAEVHITRSDVGKGHPEYYQDVAARLAQDIPGAFFADQFNNPANPLAHECGTG
FT                   PELWAQTGHDLDAIVVGVGSSGTLTGLTRFFQKVQPELEMVLADPEGSIMAEYSRSGTL
FT                   GTPGSWAVEGIGEDFVPAIADLSSVRHAYSISDEESFAMARELLRVEGIPGGSSTGTLL
FT                   AAALRFCREQKEPKRVVSFVCDTGTRYLSKIYNDQWMTDQGLLQRKHYGDLRDIIARRF
FT                   EEGRVISVGPDDTLLTAFQRMRLADVSQLPVLDDGKLVGVIDESDILLGVHADAPRFRD
FT                   AVSSAMNAAPETLAPGASLAQLQAVLDRGLVAIVADASGFHGLITRFDLLNHLRRKLT"
FT   gene            456745..457929
FT                   /locus_tag="PA14_05230"
FT   CDS_pept        456745..457929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05230"
FT                   /product="probable cystathionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15367"
FT                   /db_xref="GOA:A0A0H2ZKV7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV7"
FT                   /protein_id="ABJ15367.1"
FT                   /translation="MSQHDQHPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYIQ
FT                   ESPGVHKGLDYGRSHNPTRWALERCVADLEGGAQAFAFASGLAAISSVLELLDAGSHIV
FT                   SGNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLQAFEAALTPETRMVWVETPSNPLLRL
FT                   TDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIGGIAI
FT                   VGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQWLERQP
FT                   QVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSLAESLGG
FT                   VESLIEHPAIMTHASIPAETRADLGIGDSLIRLSVGVEALEDLQADLAQALAKI"
FT   gene            complement(458157..459428)
FT                   /gene="pyrC"
FT                   /gene_synonym="pyrX"
FT                   /locus_tag="PA14_05250"
FT   CDS_pept        complement(458157..459428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /gene_synonym="pyrX"
FT                   /locus_tag="PA14_05250"
FT                   /product="noncatalytic dihydroorotase-like protein
FT                   noncataly"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15368"
FT                   /db_xref="GOA:A0A0H2ZL93"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL93"
FT                   /protein_id="ABJ15368.1"
FT                   /translation="MTISIRGARVIDPASGLDQVGDLHIEAGKIVAIGAAPAGFSAQKT
FT                   LDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDTPA
FT                   VAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRIL
FT                   RRALEYAATFDLTVIFTSQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLV
FT                   EQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPP
FT                   LRTKADREALREAVKNGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLV
FT                   QDGLLDLPTLLARLSHGPAQALRLPAGRLAVGQAADLVLFDPQGSTLAGESWYSKGQNS
FT                   PFVGHCLPGRVRYTLVDGHLTHEG"
FT   gene            complement(459425..460429)
FT                   /gene="pyrB"
FT                   /locus_tag="PA14_05260"
FT   CDS_pept        complement(459425..460429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="PA14_05260"
FT                   /product="aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15369"
FT                   /db_xref="GOA:Q02U10"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U10"
FT                   /protein_id="ABJ15369.1"
FT                   /translation="MPTDAKRPLQLNDQGQLRHFISLDGLPRELLTEILDTADSFLEVG
FT                   ARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLTD
FT                   TLRNLEAMAADMFVVRHSDSGAAHFIAEHVSPNVAVINGGDGRHAHPTQGMLDMLTIRR
FT                   HKGNFEQLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPRTLLPIGLEEQYGVRVF
FT                   TNADEGLKDVDVVIMLRLQRERMQGGLLPSEGEFFKLYGLTEKRLKLAKPDAIVMHPGP
FT                   INRGVEIESAVADGAQSVILNQVTYGIAIRMAVLSMAMSGQNTQRQLEQEDAE"
FT   gene            complement(460453..460965)
FT                   /gene="pyrR"
FT                   /locus_tag="PA14_05270"
FT   CDS_pept        complement(460453..460965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="PA14_05270"
FT                   /product="transcriptional regulator PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15370"
FT                   /db_xref="GOA:Q02U09"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U09"
FT                   /protein_id="ABJ15370.1"
FT                   /translation="MSLPNPAELLPRMASDLRAHLAERGIERPRFVGIHTGGIWVAEAL
FT                   LRELGNQEPLGTLDVSFYRDDFTQNGLHPQVRPSALPFEIDGQHLVLVDDVLMSGRTIR
FT                   AALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVKLVGPAPLALER
FT                   KVLSSAS"
FT   gene            complement(461077..461511)
FT                   /gene="yqgF"
FT                   /locus_tag="PA14_05280"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0404"
FT   CDS_pept        complement(461077..461511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="PA14_05280"
FT                   /product="putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15371"
FT                   /db_xref="GOA:Q02U08"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U08"
FT                   /protein_id="ABJ15371.1"
FT                   /translation="MASDKPLRLLLGFDYGTRQIGVAVGQAVTGQARELCVLKAQNGVP
FT                   DWNRVEALIKEWQPDAIVVGLPLNMDGSPSEMSERAEKFGRRLNGRFNLPVFTHDERLT
FT                   TYAAKGERLAQGQRDGYRERPVDALAAALLLEGWLAEHPD"
FT   gene            complement(461511..462080)
FT                   /gene="algH"
FT                   /locus_tag="PA14_05290"
FT   CDS_pept        complement(461511..462080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algH"
FT                   /locus_tag="PA14_05290"
FT                   /product="putative transcriptional activator of alginate
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15372"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U07"
FT                   /protein_id="ABJ15372.1"
FT                   /translation="MKQSSPTYLKHHFLIAMPHMADPNFAQTVTYLVEHNEQGAMGLVI
FT                   NRPSGLNLAEVLEQLKPDALPPARCQHIDIYNGGPVQTDRGFVLHPSGLSYQSTLELGE
FT                   LAMSTSQDVLFAIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPADPAILFDLP
FT                   AEERLSAAAARLGVNLSLLTAQAGHA"
FT   gene            complement(462129..463088)
FT                   /locus_tag="PA14_05300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0406"
FT   CDS_pept        complement(462129..463088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05300"
FT                   /product="putative tonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15373"
FT                   /db_xref="GOA:A0A0H2ZKI4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI4"
FT                   /protein_id="ABJ15373.1"
FT                   /translation="MRHRLFRPPSADFAPRQPPRSAMNAAVLKSPSAAAGVRPADRLGF
FT                   TLFIAAILHVAFILGVGFSMPAPSQISKTLEITLATFKSDKAPEKADYLAQMNQQGSGT
FT                   LEHKAAPKTTEVAPFQDNQVKKVAPPATPKQARSEEAPKAAVTTTRQRQQKAPSKTQAQ
FT                   KAEQVAKPAPHFDSTQLSAEIASLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKE
FT                   DWRKKIERIGNLNYPDEARRQKLYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQR
FT                   IVRLAAPYAPFSGDLADIDRLEIIRTWRFERGDRLSSK"
FT   gene            complement(463169..464122)
FT                   /gene="gshB"
FT                   /locus_tag="PA14_05310"
FT   CDS_pept        complement(463169..464122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="PA14_05310"
FT                   /product="glutathione synthetase'"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15374"
FT                   /db_xref="GOA:A0A0H2ZK52"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK52"
FT                   /protein_id="ABJ15374.1"
FT                   /translation="MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLY
FT                   QKAGVARGRMRPLKVFNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLE
FT                   QAERAGALVVNRPQSLRDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPL
FT                   DGMGGSSIFRHREGDPNLSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPVPY
FT                   CLARIPAQGETRGNLAAGGRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLT
FT                   EINVTSPTCIREIDQAFDTRIGDKLMDAIAAQLAAR"
FT   gene            464377..464784
FT                   /gene="pilG"
FT                   /locus_tag="PA14_05320"
FT   CDS_pept        464377..464784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="PA14_05320"
FT                   /product="type IV pili response regulator PilG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15375"
FT                   /db_xref="GOA:A0A0H2ZL28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL28"
FT                   /protein_id="ABJ15375.1"
FT                   /translation="MEQQSDGLKVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDALA
FT                   KIADTHPNIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKEELLGAIKAHVPSFTPVDAVS"
FT   gene            464831..465196
FT                   /gene="pilH"
FT                   /locus_tag="PA14_05330"
FT   CDS_pept        464831..465196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="PA14_05330"
FT                   /product="type IV pilus response regulator PilH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15376"
FT                   /db_xref="GOA:A0A0H2ZKW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW2"
FT                   /protein_id="ABJ15376.1"
FT                   /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEK
FT                   PDVVLMDIVMPGLNGFQATRQLTKDAETSAIPVIIVTTKDQETDKVWGKRQGARDYLTK
FT                   PVDEETLLKTINAVLAG"
FT   gene            465247..465783
FT                   /gene="pilI"
FT                   /locus_tag="PA14_05340"
FT   CDS_pept        465247..465783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PA14_05340"
FT                   /product="type IV pili signal transduction protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15377"
FT                   /db_xref="GOA:A0A0H2ZL98"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL98"
FT                   /protein_id="ABJ15377.1"
FT                   /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGR
FT                   FFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQR
FT                   RVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFS
FT                   PHALAQHQGFLDVAV"
FT   gene            465868..467916
FT                   /gene="pilJ"
FT                   /locus_tag="PA14_05360"
FT   CDS_pept        465868..467916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="PA14_05360"
FT                   /product="type IV pili methyl-accepting chemotaxis
FT                   transducer PilJ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15378"
FT                   /db_xref="GOA:A0A0H2ZKI7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI7"
FT                   /protein_id="ABJ15378.1"
FT                   /translation="MKKINAGNLFAGMRSSSVIAGLFIVLIVSIVLLFANFAYLNTQSN
FT                   HDKQYIGHAGELRVLSQRIAKNATEAAAGKGEAFKLLKDARNDFEKRWNILVNGDESTS
FT                   LPPSPEAVKPQMDVVQQDWDGLRKNADSILASEQTVLSLHQVASTLAETIPQLQVEYEE
FT                   VVDILLENGAPADQVAVAQRQSLLAERILGSVNKVLAGDENSVQAADSFGRDASLFGRV
FT                   LKGMQEGNAAMSISKVTNAEAVDRLNEIAELFEFVSGSVDEILETSPDLFQVREAANNI
FT                   FSVSQTLLDKASQLADGFENLAGGRSINLFAGYVLGALALASIILIGLVMVRETNRRLA
FT                   ETAEKNDRNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQLRELVET
FT                   INQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMAVSIDQVSANASESSA
FT                   VAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIAD
FT                   QTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAV
FT                   ISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTM
FT                   NVIQEITSQTSAGTTATARSIGNLAKMASEMRNSVSGFKLPEGVEQA"
FT   gene            467977..468852
FT                   /gene="pilK"
FT                   /locus_tag="PA14_05380"
FT   CDS_pept        467977..468852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilK"
FT                   /locus_tag="PA14_05380"
FT                   /product="methyltransferase PilK"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15379"
FT                   /db_xref="GOA:A0A0H2ZK56"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK56"
FT                   /protein_id="ABJ15379.1"
FT                   /translation="MQANGVWSLQPLADMSAAEFRDWQVLLENRTGVVLNEQRRTFLQA
FT                   SLTARMRELGIGDYHSYYRQVTDGPRGAVEWATLLDRLTVQETRFFRHPPSFELLERYL
FT                   GERLRREGMPRPWALWSVGCSSGEEPYSLAMCAAQALRGQEREDFFGVTGTDISLHALQ
FT                   RARQANYPARKLEQLEAGLVERYCERQADGSFSVKTILTERVCCARLNVLDLAKAPWSG
FT                   MDVIFCQNLLIYFRRWRRREILNRLAERLAPGGLLVIGVGEVVDWSHPELEPVADERVL
FT                   AFTRKGYSGT"
FT   gene            468864..476294
FT                   /gene="chpA"
FT                   /locus_tag="PA14_05390"
FT   CDS_pept        468864..476294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpA"
FT                   /locus_tag="PA14_05390"
FT                   /product="ChpA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15380"
FT                   /db_xref="GOA:A0A0H2ZL32"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL32"
FT                   /protein_id="ABJ15380.1"
FT                   /translation="MGDRHDYVALEWVKGEIAETLKQARQALEAFVENPQDPTRMRFCL
FT                   TYVHQVQGTLQMVEFYGAALLAEEMEQLVQALLDGRVPNQSEALEVLMQAILQLPVYLD
FT                   RIQTARRDLPMVVLPLLNDLRAARGEKLLSETSLFAPDLSQRQPQLDGEAIAQLRTDEL
FT                   GGLLRKLRQTQQMALVGLLRNQDVATSLGYLARVYARLEGLCREAPLGPLWSIASGLVE
FT                   GLANGSVVNSASVRTLLRQLDRELKRLVEQGADGLNQAAPDELVKNLLFYVAKAPSQSP
FT                   RIRALKEQYRLDEALPDHETVDAERARLAGPDRDAMRSVVGALCEELVRIKDSLDLFVR
FT                   SDRGHPSELDALLAPLKQIADTLAVLGFGQPRKVILDQLDVIHALAQGRREPSDAILMD
FT                   VAGALLYVEATLAGMAGPGDERNSEESRLPTTDVAQIHQLVIKEARNGLEQAKDAIIEF
FT                   IASQWNHEHLARVPELLTQVRGGLAMIPLERAATLLETCNRYIQEQLLARKAVPDWQSL
FT                   DTLADAITSVEYYLERLSEDHASQSDLILDVAEDSLANLGYTLKPNSSAPAEPGLSGPA
FT                   AIASPAAEPERPEAVVEVAETAEQPPADTAPAEAARGDAPLLASDDNWTLGEVAPDAGE
FT                   PSLDLALDLPLDDSAEVPPALPEVVEESGQPQSTPAPARSLDDFSLDEIDLSGLDLPAD
FT                   AAPASGPAALADWSLPEQWGLGDDLAQPAQADETLDLSLEEPALSFDAPLESLEPLPAL
FT                   EPFDGSAEQELVLDALDPLPLDVALPEAEGEVSAWEGSSLEELDLSDLDLPEVQLPEAE
FT                   APPAAEALASAAPALSLAEVMAAPVQPINPPAQNVPVSLLPPPADEEPVDEELREVFIE
FT                   EAGEVLETLGRYLPAWKADHDDRDALTEVRRAFHTLKGSGRMVRALVIGELAWSIENLF
FT                   NRVLDRSIAASEPVQRVVDQVVALLPELVEEFAANAQRQRDDVDLLAATAHALAKGEPL
FT                   PEPPAPDDGGVPPEAGAEQPSSLENGVQAPPLADAPQAAAEAQSDVELLDPQLLEIFTN
FT                   EAETHLEALVGFLADCARELPQPVTDALQRALHTLKGSAHMAGILPIAEIATPLEKLVK
FT                   EYKSNLLAFDLREAELLHDAEQLFRIGLEQVGAHRPLNPIPGSDALLERIEALHQERIA
FT                   SLEAERYSDAGERRDPLLIEAFLVEGMDILLDAEDLLERWHEHPQERQELSALREELSA
FT                   LDQGARHAELPQVEELCQALLALYDAVEEGRLAVSPAFFEEARQAHEALIGMMDQVAAG
FT                   LQVTPRPERVAALQELLEAPAAEAVPFIDPESLGADDFPPEDEELALPEAVFEEAGTPA
FT                   EETVPAAPAPAPGRELDEEMVSIFLEEAVDILESAGQALAQWQAEPGALSSLSALQRDL
FT                   HTLKGGARMAEIAEIGDLAHELEALYEGLVDRRYQHSPQLAGLLQACHDRLAEQLDQLS
FT                   AGQPLADPHDLIQAIRRFRQGPLAEAATPGEAESPVEELVAPAVEVPAAPAATQPPAAE
FT                   AFEERDPELVEIFLEEGFDILDSAAAALQRWIDDVDNTIELEALQRDLHTLKGGARMAE
FT                   IGEIGDLAHELEFLYEGLCGGRLRASPALFGLLQRCHDELAEMLEAVRGHRTLPDGQAL
FT                   IAEIRRLRSDPDEQLSVPTSVSLKPLAAKGAAADESEILDIFLEEADDLLENLELALGR
FT                   WDGGNGDAQPLDDLLRILHTLKGGARLAGQTELGNLAHDLEQHLTDAQQQGAPWPDSLL
FT                   LDAQSGLEGLQRQVDLLRERLAEDDEAGERPEPAQALVQADDTDRAVASALAELTRLAP
FT                   AAGAIMAAEAAPPAAPATTLPFVRKAQEAAQEAASRRAPQELVKVPAELLENLVNLAGE
FT                   TSIFRGRVEQQVSDVGFTLGEMESTIERVRDQLRRLDTETQAQILSRHQADAERAGYEE
FT                   FDPLEMDRYSQLQQLSRALFESASDLLDLKETLAAKNRDAETLLLQQARVNTELQEGLM
FT                   RTRMVPFDRLVPRLRRIVRQVAGELGKQVEFVVGNADGEMDRTVLERIVAPLEHMLRNA
FT                   VDHGIESGETRRAAGKPEHGTIRLNIGREGGDILLTLSDDGAGIRLDAVRRKAIERGLM
FT                   SADSDLSDHEVLQFVLESGFSTAEKVTQISGRGVGLDVANSEVKQLGGSVSIQTEPGQG
FT                   TRFNVRLPFTVSVNRALMVLSGEDLYAVPLNTIEGIVRVSPYELEALYDQRGEAGLDTP
FT                   SFEYAGQSYELKYLGELLNNGQEPKLVGQSLPLPVILVRSSEHAVAVQVDSLAGSREIV
FT                   VKSLGPQFAGVAGISGATLLGDGRVVVILDLLATIRSRHALLGQENRRERLALRQEMAA
FT                   SESEQQRPPLVMVVDDSVTVRKVTTRLLERNGMNVLTAKDGVDAIAQLQEHRPDILLLD
FT                   IEMPRMDGFEVATLVRHDERLGNLPIIMITSRTGEKHRERALGIGVNQYLGKPYQETEL
FT                   LEAIQSLVGQHE"
FT   gene            476287..477318
FT                   /locus_tag="PA14_05400"
FT   CDS_pept        476287..477318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05400"
FT                   /product="probable methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15381"
FT                   /db_xref="GOA:A0A0H2ZKW7"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW7"
FT                   /protein_id="ABJ15381.1"
FT                   /translation="MSERATPRVAVIADTSLQRHVLQQALLGHGYEVVLNADPARVDDA
FT                   ALECAPDLWLVDLTQQDDSPLLDSLLEQDCAPVLFGEGHAPERHTEHYPRWERRLIGKL
FT                   KRLIGDPSDGVGDSLGALLDEERPPRLEIPGDLAAMPLQAGEAAREVWLLAASLGGPAA
FT                   VKAFLDALPGGLPIGFLYAQHIDASFEQNLPQAVGRHSQWHVKNVRDGEALRCGEVMVV
FT                   PVLHELGFHHDGRLKCSQRPWPEPYTPSIDQMMLNLAQQFGPDCGVIVFSGMGSDGSAA
FT                   AAYVRRQGGEVWTQRADSCVCSSMPDSLREAGYSSFNASPRELAEALVKHLAARCAPTG
FT                   VET"
FT   gene            477315..477821
FT                   /gene="chpC"
FT                   /locus_tag="PA14_05410"
FT   CDS_pept        477315..477821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpC"
FT                   /locus_tag="PA14_05410"
FT                   /product="putative chemotaxis protein methyltransferase
FT                   CheR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15382"
FT                   /db_xref="GOA:A0A0H2ZLA3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA3"
FT                   /protein_id="ABJ15382.1"
FT                   /translation="MNQAVIEQDGMSRNTPANPTPDSLTGLLLPLSDRTLLLPNVAVAE
FT                   LIAYRNPQVAAGVPQWYLGQVAWRDLRLPLLSFEAASSGEQQPVLGSSARVVVINALGG
FT                   RPHVKFLALLVQGIPRSVRLDANLASTAAPLAALELAAVDIGGETARIPDLAGLEEKLA
FT                   DAGLI"
FT   gene            477829..478623
FT                   /gene="chpD"
FT                   /locus_tag="PA14_05420"
FT   CDS_pept        477829..478623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpD"
FT                   /locus_tag="PA14_05420"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15383"
FT                   /db_xref="GOA:A0A0H2ZKJ1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ1"
FT                   /protein_id="ABJ15383.1"
FT                   /translation="MAGLQHARIGASLEVASASLAGHRFEKHSHDEFVISANLCGLEDV
FT                   WLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELASSLDLSSVEFDRP
FT                   LLRNPALGRELAASIEALLASDRFARERGEERLLEFLGRLLAASGTRLPQRADPGRPAV
FT                   ARLQALLAERLAEPPDLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLL
FT                   RRGLAVGEVAHALGFADQSHLTRYFTSAYGISPGRYQRAVRG"
FT   gene            478700..479311
FT                   /gene="chpE"
FT                   /locus_tag="PA14_05430"
FT   CDS_pept        478700..479311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpE"
FT                   /locus_tag="PA14_05430"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15384"
FT                   /db_xref="GOA:A0A0H2ZK58"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK58"
FT                   /protein_id="ABJ15384.1"
FT                   /translation="MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGS
FT                   LIGDAVWALLGLTGLALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGE
FT                   QGRNAFGAGAAISLSNPKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCF
FT                   CCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
FT   gene            complement(479319..480734)
FT                   /locus_tag="PA14_05440"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0418"
FT   CDS_pept        complement(479319..480734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL36"
FT                   /protein_id="ABJ15385.1"
FT                   /translation="MNTVAQPTSQRIARMDTPVTFDWKIRLPDVLGVLRRDYAGRFPQL
FT                   ASAALETLLERLRDDLPEDFLPALGQELESLGLALVERLDEDDSLNLYVVGATHSQRLL
FT                   DALAAQGHNARTLRQENAPEGARAALPAAAPAGLAPASAYICLEHAEHLAPGLAIARLP
FT                   GEDSRNLLDLRQWPRLQRLPDGAEETQGALLCRASSADGLHAWVRMTRSGSPYAWLHRS
FT                   RDLASLTPELPPLPLPPAQSLRQRRTPELAIGLAGDDLLLADRGLFFLYPGFAQGNDEP
FT                   RLLFEVPQARHSIENPPAVFTTPDQRVCLLSRGQFFEWREARIQPLPFPVGKDLPADPA
FT                   QPTSAAPGTIVWLERETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLE
FT                   PHRSRDLAQLWHLESGRALRIRYGELDLEGGLQHWAELPDGRIVVGDHARHVDLGRFES
FT                   LRQRLLRRRLAPA"
FT   gene            complement(480769..481491)
FT                   /locus_tag="PA14_05450"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0419"
FT   CDS_pept        complement(480769..481491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15386"
FT                   /db_xref="GOA:A0A0H2ZKX2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX2"
FT                   /protein_id="ABJ15386.1"
FT                   /translation="MRLSRFFVDQPLALGQHDLPETQAHYIGRVLRHATGDAVQLFDGS
FT                   GREYLGELVEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVA
FT                   EITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRD
FT                   DELRLVLHPVAAPLASHVPPSRLAFLVGPKGGLSDAEVEQAKAAGFHAARLGPRVLRTE
FT                   TAPVVALAVAQQLWGDFA"
FT   gene            complement(481584..482987)
FT                   /gene="bioA"
FT                   /locus_tag="PA14_05460"
FT   CDS_pept        complement(481584..482987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="PA14_05460"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15387"
FT                   /db_xref="GOA:A0A0H2ZLA8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA8"
FT                   /protein_id="ABJ15387.1"
FT                   /translation="MGLNADWMQRDLNVLWHPCTQMKDHERLPVIPIRRGEGVWLEDFE
FT                   GKRYIDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKITP
FT                   PGLDRVFYADSGSAGIEVALKMSYHFWLNSGRPRKKRFVTLTNSYHGETIAAMSVGDVA
FT                   LFTETYKSLLLDTIKVPSPDCFLRPDGMCWEEHSRNMFAHMERTLAEGHDEIAAVIIEP
FT                   LIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIAPDFLC
FT                   LSKALTGGYLPMSAVLTSETIYRGFYDDYQTLRAFLHSHTYTGNPLACAAALATLDIFE
FT                   EDKVIEANRALSTHMARATAHLADHPHVAEVRQTGMVLAIEMVQDKASRTPYPWQERRG
FT                   LKVFQHGLERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRDAVSVAVSD
FT                   FHPDHRDPG"
FT   gene            483161..484651
FT                   /locus_tag="PA14_05480"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0421"
FT   CDS_pept        483161..484651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05480"
FT                   /product="putative monoamine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15388"
FT                   /db_xref="GOA:A0A0H2ZKJ4"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ4"
FT                   /protein_id="ABJ15388.1"
FT                   /translation="MSLRWLRAAAFLMLGVFSAVALGKDKQPTAIVVGAGLAGLSAAYE
FT                   LQKDGWQVTVLEARPQVGGRSGLATSEWVGNQKVQPTLNAYLDTFKLKPVPAPDFVRTP
FT                   SYLIDGLYYSSSDLALKQPNVAADLKRFESTLDDLSASISDPLNPASSNTLFALDQMNA
FT                   ARWLDKLNLSPTARLLVNQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAARLPGG
FT                   SQVLAEAFVKQIKTIKTKSKVSSIVQAKDGVAVKAGSETYKADYVVLAVPLKALGQIQM
FT                   TPSLSGTQMSALKGTNYGWRDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWVEPALKG
FT                   GANVLINLSGDNARVLQAFGDRQMVDQVLIRMNKFYPKMRGAFGGYEIRRYSADPGTGG
FT                   SYLAYGPGQVTRFWRIWEQPLSRVAFAGEHTDALYPGTIEGALRSGKRAASQVRDLYAG
FT                   KTPVIEGAPMVAKAEKVAAPTTGGEKKNPFAWFTRLFD"
FT   gene            484832..485401
FT                   /locus_tag="PA14_05500"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0422"
FT   CDS_pept        484832..485401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05500"
FT                   /product="putative cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15389"
FT                   /db_xref="GOA:A0A0H2ZK62"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK62"
FT                   /protein_id="ABJ15389.1"
FT                   /translation="MQWRNTSSRYGVFSLFLHWGSALVVFGLFGLGLWMRELSYYDPWY
FT                   HPAPALHKSIGILLAIALLVRIVWRFVSPPPPAPANHGPLTRVASKLGHLALYGLLLAV
FT                   IVAGYLISTADGEPISVFGWFSVPATLSGLPDQADVAGEIHLYLAWALVVFAVLHALAA
FT                   LKHHFVDRDPTLKRMLGRSSNDQQPR"
FT   gene            485413..485988
FT                   /gene="yceI"
FT                   /locus_tag="PA14_05510"
FT   CDS_pept        485413..485988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceI"
FT                   /locus_tag="PA14_05510"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15390"
FT                   /db_xref="GOA:Q02TY9"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TY9"
FT                   /protein_id="ABJ15390.1"
FT                   /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVSKNP
FT                   TATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLIGQGDDPWGGYRAGFEGSATLK
FT                   LKDFGIKMDLGPASQEVELLLSVEGIRQ"
FT   gene            complement(486057..486500)
FT                   /gene="mexR"
FT                   /locus_tag="PA14_05520"
FT   CDS_pept        complement(486057..486500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexR"
FT                   /locus_tag="PA14_05520"
FT                   /product="multidrug resistance operon repressor MexR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15391"
FT                   /db_xref="GOA:A0A0H2ZL40"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL40"
FT                   /protein_id="ABJ15391.1"
FT                   /translation="MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKL
FT                   IDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAI
FT                   HQHAEAIMSRVHDELFAPLTPEEQATLVHLLDQCLAAQPLEDI"
FT   gene            486775..487926
FT                   /gene="mexA"
FT                   /gene_synonym="arpA"
FT                   /locus_tag="PA14_05530"
FT   CDS_pept        486775..487926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexA"
FT                   /gene_synonym="arpA"
FT                   /locus_tag="PA14_05530"
FT                   /product="RND multidrug efflux membrane fusion protein MexA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15392"
FT                   /db_xref="GOA:A0A0H2ZKX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX6"
FT                   /protein_id="ABJ15392.1"
FT                   /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEA
FT                   QTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQ
FT                   SAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSP
FT                   ISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERA
FT                   GDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQ
FT                   LQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNA
FT                   GDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
FT   gene            487942..491082
FT                   /gene="mexB"
FT                   /gene_synonym="acrB"
FT                   /locus_tag="PA14_05540"
FT   CDS_pept        487942..491082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexB"
FT                   /gene_synonym="acrB"
FT                   /locus_tag="PA14_05540"
FT                   /product="RND multidrug efflux transporter MexB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15393"
FT                   /db_xref="GOA:A0A0H2ZLB4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB4"
FT                   /protein_id="ABJ15393.1"
FT                   /translation="MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAV
FT                   QVSYPGASAETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQ
FT                   VQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQ
FT                   DPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGL
FT                   PAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
FT                   NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEV
FT                   VKTLGEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAF
FT                   FGGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFN
FT                   RMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQV
FT                   QTPPGSSAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSSGMAFIMLKPWE
FT                   ERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVLELGNATGFDLFLQDQAGVGHEV
FT                   LLQARNKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAW
FT                   GSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGS
FT                   PKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVKQLPKGVGYSWTGLSYEERLSGSQ
FT                   APALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLATSMRGLSNDVFFQVGL
FT                   LTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVVPLAI
FT                   STGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVSTLFKDEASKQQASVEKGQ"
FT   gene            491084..492541
FT                   /gene="oprM"
FT                   /locus_tag="PA14_05550"
FT   CDS_pept        491084..492541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="PA14_05550"
FT                   /product="major intrinsic multiple antibiotic resistance
FT                   efflux outer membrane protein OprM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15394"
FT                   /db_xref="GOA:A0A0H2ZKJ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ8"
FT                   /protein_id="ABJ15394.1"
FT                   /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNT
FT                   GAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPR
FT                   IGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLAT
FT                   EQAQRSAQTTLVASVATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALD
FT                   LRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTEVPAGL
FT                   PSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGS
FT                   WLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQ
FT                   LQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVN
FT                   LYKALGGGWNQQTVTQQQTAKKEDPQA"
FT   gene            complement(492637..494556)
FT                   /gene="rhlE"
FT                   /locus_tag="PA14_05560"
FT   CDS_pept        complement(492637..494556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="PA14_05560"
FT                   /product="putative ATP-dependent RNA helicase, DEAD box
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15395"
FT                   /db_xref="GOA:A0A0H2ZK67"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK67"
FT                   /protein_id="ABJ15395.1"
FT                   /translation="MSFSSLGLSEALARAVEAAGYSQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPVLERLFPAGHPDREHRHGPRQARVLVLTPTRELAAQVHDSFKVYAR
FT                   DLPLNSTCIFGGVGMNPQIQALAKGVDVLVACPGRLLDLAGQNKVDLSHVEILVLDEAD
FT                   RMLDMGFIHDVKKVLAKLPPKRQNLLFSATFSKDIVDLANKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLPAPQKRALLAHLVTVGAWEQVLVFTRTKHGANRLAEYLTKHGLPAAAIHG
FT                   NKSQNARTKALADFKANDVRILVATDIAARGLDIDQLPHVVNYELPNVEEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKAIEKMTRQRIPDGDAQGFDPEAVLPEVAQPEPREAPQ
FT                   KQPRRDKERRSSRERKPKDAQASNPDSNVAAAQDGTEKPAGKRRRRGGKNKENREAGQA
FT                   QQPRQSREARPAKPNRPPEVDGNRDPEEFLDDDFDNFGNRADYVSPYQGQENKGRGRRG
FT                   GQQKPQGGTGQQGRGQGQGQARGKSQGAAQGGARGQGAGQGKAKKPRASKPRGQGRENA
FT                   SRMSDAPLREPSEYGTGKQPSRQPVVINKRDLVRMDRFPTAEQLDELEPRRKGERPALL
FT                   TRNR"
FT   gene            complement(494807..495877)
FT                   /locus_tag="PA14_05580"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0429"
FT   CDS_pept        complement(494807..495877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL45"
FT                   /protein_id="ABJ15396.1"
FT                   /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDGAAHGLTVRV
FT                   YTDDPSPYAGLPVQVREVTAEELVAWCQPHGYHFRAKHVALRDALEDADQALLIDTDTF
FT                   FHSSPLRLFDRIQPGSLLCNAIGARYGEHRNFPLYRDLSPYLFERGWADDEMHQLNSGV
FT                   IGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHHYWSR
FT                   KQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLPAPMRQ
FT                   FSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPQEPIAEQIEDWLNHSLLRNLLG
FT                   SRANEIRQHLRQRDLL"
FT   gene            complement(495947..496819)
FT                   /gene="metF"
FT                   /locus_tag="PA14_05590"
FT   CDS_pept        complement(495947..496819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="PA14_05590"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15397"
FT                   /db_xref="GOA:A0A0H2ZKY2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY2"
FT                   /protein_id="ABJ15397.1"
FT                   /translation="MVASKEPIMSQSERRFSFEFFPAKTEAGHEKLLATARNLAGYKPD
FT                   FFSCTYGAGGSTRDRTLSTVLQLDGEVKVPTAPHLSCVGDSKAELRELLGRYREAGIRR
FT                   IVALRGDLPSGMGMASGELRYANELVDFIRTETGDHFHIEVAAYPEVHPQARSFEDDLA
FT                   NFVRKVKAGASSAITQYFFNADAYFYFVERVAKLGVDIPVVPGIMPITNYSKLARFSDA
FT                   CGAELPRWIRKQLEAYGDDSRSIQAFGEQVISEMCERLLEGGAPGLHFYTLNQADPSLA
FT                   IWKNLQLPR"
FT   gene            complement(496862..497416)
FT                   /locus_tag="PA14_05600"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0431"
FT   CDS_pept        complement(496862..497416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15398"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB9"
FT                   /protein_id="ABJ15398.1"
FT                   /translation="MSAPTMSTHLADRYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVA
FT                   NELLAADRDGAIERLGETLQIAVLHDTLEDTATSPEELRQQFGEFVCAGVQALSKRVGD
FT                   GPKRSLDDYLQALAEGPAQYALVKLCDRITNLQPPPQTWSQDKIANYHQESQLILARLG
FT                   HAHAATARRLREKIEHYRQYY"
FT   gene            complement(497457..498866)
FT                   /gene="sahH"
FT                   /gene_synonym="ahcY"
FT                   /locus_tag="PA14_05620"
FT   CDS_pept        complement(497457..498866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sahH"
FT                   /gene_synonym="ahcY"
FT                   /locus_tag="PA14_05620"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15399"
FT                   /db_xref="GOA:Q02TY0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TY0"
FT                   /protein_id="ABJ15399.1"
FT                   /translation="MSAVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKY
FT                   AGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHKKYPQMLERIHGITE
FT                   ETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSSQSLRQEGMIVKVAEVDPICAMQACMDGFEVVSPYKNGINDGTEA
FT                   SIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGKDGFDAYNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   HLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSV
FT                   EGPFKPDTYRY"
FT   gene            499155..499589
FT                   /locus_tag="PA14_05630"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0433"
FT   CDS_pept        499155..499589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15400"
FT                   /db_xref="GOA:A0A0H2ZKK1"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK1"
FT                   /protein_id="ABJ15400.1"
FT                   /translation="MLECAVMRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQALG
FT                   VGSDKGQKASVGLFCVAGASQWLSLDPDDGSAGDPVPVNPQLPVSCPMCSALVLFVALG
FT                   VIWSWRLQRRRQARFRPPATREPVPPRYVWPPANPRASPA"
FT   gene            499715..501907
FT                   /gene="bfrG"
FT                   /locus_tag="PA14_05640"
FT   CDS_pept        499715..501907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfrG"
FT                   /locus_tag="PA14_05640"
FT                   /product="putative outer membrane ferric siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15401"
FT                   /db_xref="GOA:A0A0H2ZK72"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK72"
FT                   /protein_id="ABJ15401.1"
FT                   /translation="MKKHSTARRVLALGLNLTLAGVPAWLWADEEPTELPALTVSAGAA
FT                   GETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVNAS
FT                   APPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLNGAG
FT                   AVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRLDVSRS
FT                   GGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPYAGELK
FT                   IDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRNLETYRY
FT                   NADNSGVVRSNAFLQRHDQQLNGNRFELQHSQPLFGLASDWALGFDYSINKQTRFPSTA
FT                   SGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDELSLVTGLR
FT                   YDHLDLDVRNHRTVTASDPAHFERRWDVLTGRAGLVYQFTPHANVYLQYSTAADPPGGV
FT                   LTSASFGQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSVADPNNPNLSV
FT                   PVGQQTSRGIEAAASLRITPKLLAEGNFAWVDAQYDEFTENVGGVAVSRKGKTPPNVPE
FT                   RVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFLSYRLDERTRITG
FT                   RVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
FT   gene            501918..503396
FT                   /locus_tag="PA14_05650"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0435"
FT   CDS_pept        501918..503396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05650"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15402"
FT                   /db_xref="GOA:A0A0H2ZL52"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL52"
FT                   /protein_id="ABJ15402.1"
FT                   /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERLA
FT                   HLPELDGCEACVPLRTALAGGDGKTPRSIRLASVGGLPTYLLDDADGRTRALAARDGRP
FT                   LAVDADRVLASARAFSGEVPMQLQGRIEEDAWTHTRNLDPHRPLWRVQTADEEGRLLYL
FT                   SSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLATVLGI
FT                   LVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPWNLFGR
FT                   GTPLDLAAYQGGSWDRALPAGLEADAVLRRLRAAGLRVRELEWRALDGEPYALGRSASG
FT                   NSLLLTADGEILRELPADRLLAAARALLPGVPMQAERLERYDFYYYPREEHSMMGYLER
FT                   RLPVWRLRFDDPRHTWVHLDPYSGAVVGVLDDGRRGSRWLFSLLHSWDWLPLLTRRPLW
FT                   DLWMLGFSLGGLVVCASGCWIGWRRLRGRRPKRR"
FT   gene            503481..504101
FT                   /locus_tag="PA14_05660"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0436"
FT   CDS_pept        503481..504101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05660"
FT                   /product="putative transciptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15403"
FT                   /db_xref="GOA:A0A0H2ZKY6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY6"
FT                   /protein_id="ABJ15403.1"
FT                   /translation="MGTHKIEIRRRNVEKILLAAEKVFAEKGYAGTSMGNIAEEAELPR
FT                   SNLHYYFSTKDELYRDVLLGLLEVWKQDALCFEMFDDPRVVLTSYIRAKMNHSRTRPHG
FT                   SKVWANEIMHGAPLLGATLDDSLYEWAKMKEAKIRQWVEEKRILSIEPSSLLYMIWAST
FT                   QHYADFGYQVEVLNGHQPLSDMQFERAVQTVTSVVLRGIGLEP"
FT   gene            complement(504138..505409)
FT                   /gene="codA"
FT                   /locus_tag="PA14_05690"
FT   CDS_pept        complement(504138..505409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="PA14_05690"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15404"
FT                   /db_xref="GOA:A0A0H2ZLC4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC4"
FT                   /protein_id="ABJ15404.1"
FT                   /translation="MLIDNLRLRGREGLWQLRVADGRIAALVPMEQAADDAGERLDGAG
FT                   GLAVPPFIEPHIHLDTTQTAGQPEWNRSGTLFEGIERWAQRKALLSHEDVKQRAWQTLK
FT                   WQIANGVQHVRSHVDVSDPTLTALKAMLEVRGEVAPWVDLQIVAFPQEGILSYPNGLEL
FT                   LEESLRLGADVVGAIPHFEFTRELGVESLHKAIDLAKRYDLPVDVHCDEIDDEQSRFLE
FT                   TLAMLAHRDGLGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVANPLVNIHLQGRF
FT                   DDYPKRRGITRVKELLGAGINTCFGHDDVFDPWYPLGTANMLQVLHMGLHVTQMMGYDE
FT                   IDGGLDLITRNSARTLGLREYGIEVGHPANLLVLPARDGFDAVRRQVPVRYSIRGGRLL
FT                   AETVPAQTTVFLEQAEAVDFTRAS"
FT   gene            complement(505399..506649)
FT                   /gene="codB"
FT                   /locus_tag="PA14_05700"
FT   CDS_pept        complement(505399..506649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="PA14_05700"
FT                   /product="cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15405"
FT                   /db_xref="GOA:A0A0H2ZKK5"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK5"
FT                   /protein_id="ABJ15405.1"
FT                   /translation="MSADSNYSQQPVPLAARKSALALSVVMLGLTFFSASMWTGGTLGT
FT                   GLSYDDFFLAVLLGNLMLGLYTAILGFIGARTGLSTHLLAHYSFGSKGSWLPSALLGGT
FT                   QVGWFGVGVAMFAIPVAKATGLDVNLLILVSGALMTLTVFFGIAGLTLLSAIAVPAIVV
FT                   LGSYSVWLAVRDAGGLAALQQVTPSAPLSLSTAIALVVGSFVSAGTLTADFVRFGRSAR
FT                   TAVVVCLVAFFLGNSLMFIFGAAGAAAVGKSDISDVMIAQGLLIPAILVLGLNIWTTND
FT                   NALYASGLGFANITGLSSRFLAMLNGALGTLAALWLYNHFVGWLTFLSAAIPPIGGVII
FT                   ADYLSRRRRYRQHPCADIQAINWAAILAVACGTAAGHWLPGIVPVNAVLGAAIAYLLLN
FT                   PLLSRSPNKPEEVLHAD"
FT   gene            complement(506831..508108)
FT                   /gene="pydA"
FT                   /locus_tag="PA14_05740"
FT   CDS_pept        complement(506831..508108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pydA"
FT                   /locus_tag="PA14_05740"
FT                   /product="putative dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15406"
FT                   /db_xref="GOA:A0A0H2ZK76"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK76"
FT                   /protein_id="ABJ15406.1"
FT                   /translation="MMADLSIEFAGIKSPNPFWLASAPPTDKAYNVVRAYQAGWGGVVW
FT                   KTLGEDPAAVNVSSRYSAHFGPNRQVQGINNIELITDRSLEINLREIAQVKKDWPDRAL
FT                   IVSLMVPCVEESWKYILPLVEATGADGIELNFGCPHGMPERGMGAAVGQVPEYVEMVTR
FT                   WCKTHCSLPVIVKLTPNITDIRQSARAAHRGGADAVSLINTINSITSVDLERMVALPVV
FT                   GTQSTHGGYCGSAVKPIALNMVAEIARDPQTRGLPICGIGGIGSWRDAAEFVALGCGAV
FT                   QVCTAAMLHGFRIVEDMQDGLARWMDSHGYQRLSDFSGGAVGNTTDWKYLDINYQVIAR
FT                   IDQDACIGCGRCHIACEDTSHQAIASLPRADGTHRYEVIDAECVGCNLCQITCPVENCI
FT                   EMVPQDTGKPYLNWTQDPRNPYREAS"
FT   gene            complement(508105..509472)
FT                   /gene="gltX"
FT                   /locus_tag="PA14_05750"
FT   CDS_pept        complement(508105..509472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="PA14_05750"
FT                   /product="putative glutamate synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15407"
FT                   /db_xref="GOA:A0A0H2ZL57"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL57"
FT                   /protein_id="ABJ15407.1"
FT                   /translation="MIDSLNHLPRPDAGADTLAERFADLAPPLNARQAALESARCLYCY
FT                   DAPCVNACPTEIDIPGFIRSIAQENVQGAAQKILSANILGGSCARVCPTEILCQRACVR
FT                   NNAQECAPVLIGQLQRYALDHAGFGEHPFKRSPATGKRIAVVGAGPAGLSCAHRLAMHG
FT                   HDVVLFEARAKVGGLNEYGIARYKLVDDFARREVEFLLQIGGIELRHGQRLGDNLALGA
FT                   LHDEYDAVFLGIGLAASKRLGLEDEDAPGLLAATDYIRELRQSDDLLDLPVADRCIVIG
FT                   AGNTAIDMAVQMSRLGARDVNLVYRRGFEEMGATGHEQEIAKASQVRLLTWARPERVLL
FT                   DEQGRVRGMRFARTRLENGRLGDTGEHFELAADAIFKAIGQAFEGASLGDPLAAQLRRD
FT                   GERIQVDGQMRTSIPGIYAGGDCVALGEDLTVQAVQHGKLAAEAIHAQLMLNVEAA"
FT   gene            complement(509567..511006)
FT                   /gene="dhT"
FT                   /locus_tag="PA14_05770"
FT   CDS_pept        complement(509567..511006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhT"
FT                   /locus_tag="PA14_05770"
FT                   /product="dihydropyrimidinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15408"
FT                   /db_xref="GOA:A0A0H2ZKY9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY9"
FT                   /protein_id="ABJ15408.1"
FT                   /translation="MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLETPSGCDVLD
FT                   GGGQYLMPGGIDPHTHMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPRQSLLE
FT                   AFHTWRGWAQKSAADYGFHVAITWWSDEVAREMGELVAQHGVNSFKHFMAYKNAIMAAD
FT                   DTLVASFERCLELGAVPTVHAENGELVFHLQQKLLAQGLTGPEAHPLSRPPQVEGEAAS
FT                   RAIRIAETLGTPLYLVHISSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYRHPDWA
FT                   TAAGYVMSPPFRPVEHQEALWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSKIPNGTA
FT                   GIEDRMALLWDAGVNSGRLSMHEFVALTSTNTAKIFNLFPRKGAIRVGADADLVLWDPQ
FT                   GSRTLSAATHHQRVDFNIFEGRTVRGIPSHTISQGKLLWAAGDLRAEPGAGRYVERPAY
FT                   PSVYEVLGRRAERQRPVAVER"
FT   gene            complement(511113..511229)
FT                   /locus_tag="PA14_05775"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0442"
FT   CDS_pept        complement(511113..511229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05775"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL41"
FT                   /protein_id="ABJ15640.1"
FT                   /translation="MVRTLTILVIFIFNYLKSISYKLKQPFENNLAQSMISI"
FT   gene            511622..513112
FT                   /locus_tag="PA14_05790"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0443"
FT   CDS_pept        511622..513112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05790"
FT                   /product="putative permease for cytosine/purines, uracil,
FT                   thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15409"
FT                   /db_xref="GOA:A0A0H2ZLC8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC8"
FT                   /protein_id="ABJ15409.1"
FT                   /translation="MQQSRSEVTERDGLVELSAGSDVLDSPRYNHDIAPTRVEQRTWNR
FT                   WHITALWIGMSICVPTYTLGGVLTAYFGLSVGEALLAILLANLVVLIPLTLNAFAGTRY
FT                   GIPFPVLLRASFGIIGSNVPCLIRAVVACGWFGIQTLFGGLAIHLFLGSIFPAWKALGG
FT                   TGEVIGFLLFWGLNLWVVLRGAESIKWLETLSAPLLVLVGLGLLVWALPHISVSELLAQ
FT                   PPKRPEGASVTGYFMAGLTAMVGFWATLSLNIPDFSRYARSQKDQILGQIFGLPLTMFL
FT                   FAALGVVMTAASASLVGETVSDPVSLIGHIPSPGWVAVAMALIIVATLSTNTAANIVSP
FT                   TNDFQNIAPKLIGRTRAVWLTGFIGLALMAHELLKKLGWIVSDLSLESVYSNWLLGYSS
FT                   LLGPIAGIMVVDYFLVRRQRLDLAGLYRDDVYPAWNWPGFAAFAVPVALTVMALGNRQF
FT                   HWFYDYGWFTGSLLGGALYYGLCGRRARSPAALAKPLP"
FT   gene            513171..514454
FT                   /gene="amaB"
FT                   /locus_tag="PA14_05810"
FT   CDS_pept        513171..514454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="PA14_05810"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15410"
FT                   /db_xref="GOA:A0A0H2ZKK9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK9"
FT                   /protein_id="ABJ15410.1"
FT                   /translation="MSTARNVLQSTQRHIDGQRLWQSLMDLARLGATAKGGVCRLALSD
FT                   LDRQARDLFVQWCEAAGCTVSVDRVGNIFARRPGRNPDLPPVMTGSHIDTQPTGGKFDG
FT                   CFGVMAGLEVIRTLNDLGVETEAPLEVVVWTNEEGSRFAPCMMGSGVFAGKFTLEETLA
FT                   KRDADGVSVGEALDAIGYAGARDCLGHPVGAYFEAHIEQGPILEDEEKTIGVVLGALGQ
FT                   KWFDLSLRGVEAHAGPTPMHLRKDALVGAAAVVEAVNRAALGHQPHACGTVGCLHAYPG
FT                   SRNVIPGEVKMTLDFRHLQPERLDSMIAEVRQVIAATCEKHGLQYELVPTADFPPLYFD
FT                   QGCVGAVREAAQALGMPQMDIVSGAGHDAIFLAELGPAGMIFVPCENGISHNEIENASP
FT                   DDLAAGCAVLLRAMLKASEAIAGGRLAA"
FT   gene            complement(514655..515878)
FT                   /locus_tag="PA14_05820"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0446"
FT   CDS_pept        complement(514655..515878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05820"
FT                   /product="putative acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15411"
FT                   /db_xref="GOA:A0A0H2ZK81"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK81"
FT                   /protein_id="ABJ15411.1"
FT                   /translation="MPGALSHIRVLDLSRVLAGPWAGQILADLGAEVIKIERPGSGDDT
FT                   RAWGPPFLKDAEGNDTSEAAYYLSANRNKKSVTVDFTQPEGQRIVRELAAKADILLENF
FT                   KVGGLKAYGLDYESLKQVNPKLIYCSITGFGQSGPYAKRAGYDFMIQGLGGLMSLTGRA
FT                   DNEEGAGPVKVGVALTDILTGLYSSTAVLAALAHRDVSGIGQHIDMALLDVQVACLANQ
FT                   TLNYLTTGVPPRRLGNAHPNIVPYQDFPTADGDMILTVGNDSQFRKFAELADHPEWADD
FT                   PRFATNKARVANREVLIPLIRQATVLHTTAEWILSLERAGVPCGPINDLAQVFADPQVQ
FT                   ARGLRVELPHPLAGTVPQVASPIRLSETPVEYRNPPPTLGQHTDEVLETLLGLDAAALE
FT                   RLRDGKVI"
FT   gene            complement(515998..517179)
FT                   /gene="gcdH"
FT                   /locus_tag="PA14_05840"
FT   CDS_pept        complement(515998..517179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="PA14_05840"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15412"
FT                   /db_xref="GOA:A0A0H2ZL63"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL63"
FT                   /protein_id="ABJ15412.1"
FT                   /translation="MATKASFNWEDPLLLDQQLTEEERMVRDSAQQFAQDKLAPRVLEA
FT                   FRHEQTDPKIFREMGETGLLGATIPEAYGGSGLNYVCYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIHEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKVDGGYR
FT                   LSGSKMWITNSPIADVFVVWAKDDEGQIRGFVLEKGWEGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENAFPEVRGLRGPFTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIA
FT                   RLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFF"
FT   gene            517400..518308
FT                   /locus_tag="PA14_05850"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0448"
FT   CDS_pept        517400..518308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05850"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15413"
FT                   /db_xref="GOA:A0A0H2ZKZ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ4"
FT                   /protein_id="ABJ15413.1"
FT                   /translation="MRRKIPSTAALVSFESAARHESFTKAAEELSLTQSAICRQIATLE
FT                   EFLGVELFRRSRRGVKLTEAGLSYSRRVAVRLDAVERDTLAVMGHQGGGAIELAVVPTF
FT                   GTQWLLPRLKRFQRLHPEVTVNLTNRTRPFLFADTEFDAALYFGDADWSGTVSHFLMRE
FT                   NPVPVCSPELLGGRRTLSAEQVAGLPLMQQSTRPYAWRQWFHSQGLNVAHDMSGPRYEL
FT                   FSMLAQAAMHGMGVALIPPFLIQDELADGRLIVPMQHAYLSENAYYLIIPERRVESAML
FT                   NAFRDWLVEEARQYREANGLG"
FT   gene            518460..518864
FT                   /locus_tag="PA14_05860"
FT   CDS_pept        518460..518864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05860"
FT                   /product="putative long-chain acyl-CoA thioester hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15414"
FT                   /db_xref="GOA:A0A0H2ZLD3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD3"
FT                   /protein_id="ABJ15414.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQR
FT                   VVTKYISEINFVSSARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMVFV
FT                   NLGPDGLPAPHGKTEITYIKDQFKEDEVLP"
FT   gene            complement(518907..520529)
FT                   /locus_tag="PA14_05870"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0450"
FT   CDS_pept        complement(518907..520529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05870"
FT                   /product="putative phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15415"
FT                   /db_xref="GOA:A0A0H2ZKL2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL2"
FT                   /protein_id="ABJ15415.1"
FT                   /translation="MTSDVLPADAVASAAGNAHKPHLEQRPGRLTALVFFAVLATGLLF
FT                   SAYSLMQDVDDVGSTITTWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPP
FT                   HFAVVWSGCFNFLGVLLSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAILWNL
FT                   GTWWLGLPASSSHTLIGSIIGVGVANALMHGRDGTSGVDWGQATKVGYSLLLSPLIGFA
FT                   CAALLLLALRLLVKNRALYKAPKGKAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLI
FT                   MLILVGTLPMAYALNRTMPADQAVQFAAVAEVTQQALVKSAPQPAPADPRQVLSDYVRS
FT                   KQASPELIPALAALTGSIGQEVKGYGAFSRVPAEAMGNVRNDMYLTSEAIRLMDKDGVG
FT                   RFDADTRGKLQAFKQKIDDATKFIPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTH
FT                   LTYAQGASAETVAMLTIGAADLYGLPVSTTHVLSSGVAGTMAANGSGLQWKTIRNLLMA
FT                   WVLTLPAAILLSASLYWLLTRLF"
FT   gene            520909..522240
FT                   /gene="nfeD"
FT                   /locus_tag="PA14_05880"
FT   CDS_pept        520909..522240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfeD"
FT                   /locus_tag="PA14_05880"
FT                   /product="putative membrane-bound protease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05880"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15416"
FT                   /db_xref="GOA:A0A0H2ZK87"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK87"
FT                   /protein_id="ABJ15416.1"
FT                   /translation="MRMPCRLALALLLCFAGPACLAASGPVRVLSVDGAIGPASADYLV
FT                   RGIERAAEDGAQLVVLELDTPGGLDASMRRIVKAILASQVPVAGFVAPSGARAASAGTY
FT                   ILYACHIAAMAPGTNLGAATPVRLGTPDKPAEKPPARDAEPMARKQVNDAAAYIRGLAQ
FT                   LRGRNVEWAERAVREAVSLAAHEAAAQRVIDLQARDLPDLLRQLDGRSLRVGERALTLA
FT                   TAGATVERQAPDWRARLLAVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLL
FT                   LGLYALQMLPLNYAGLALIALGLAFMVGEAFVASFGVLGIGGIVSFVVGALILIDTEVP
FT                   GYGIPPGLVVALALLSAALIVGLLGMALRTRRQAVVSGTAGLVGSLATVAAVDSEQPCA
FT                   GWVLLQGERWRVLAARPLAVGQPVWVLARKGLLLEVALADEGGG"
FT   gene            522237..523031
FT                   /locus_tag="PA14_05890"
FT   CDS_pept        522237..523031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05890"
FT                   /product="putative stomatin-like transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15417"
FT                   /db_xref="GOA:A0A0H2ZL69"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL69"
FT                   /protein_id="ABJ15417.1"
FT                   /translation="MMGISYGLAMLLVFLALLLFSALRILREYERGVVFQLGRFWKVKG
FT                   PGLVLVIPAIQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQVE
FT                   NYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVEIKH
FT                   VDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLRYMQT
FT                   LGAIAGDKSSTIVFPMPIELFGGKYAGAAPRNEKAAGEDEER"
FT   gene            523139..523870
FT                   /locus_tag="PA14_05910"
FT   CDS_pept        523139..523870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05910"
FT                   /product="putative bacterial periplasmic transport system"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15418"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ8"
FT                   /protein_id="ABJ15418.1"
FT                   /translation="MLRCALLLLTLLLPCALPAANLRLVGDSWPPFVDSRLPGNGLAVE
FT                   LVTTALKRAGFDSSFQQVPWSRALHGVRSGDYDIALSAWYEPARSLYGQFSRAYLSNRI
FT                   RLLQRKGRGIEFSRLSDLRPYRIAVVRDYAYAPEFDRDSRLQKVNVTSFANAARMLEAG
FT                   RVDLAVEDELALGVAFKGELADLRDKLEVLPTPLGENGLHLLVSLRNPRHDEIVEGFDL
FT                   AIRGMRDDGSYQRLLERYGAR"
FT   gene            complement(523867..526068)
FT                   /locus_tag="PA14_05920"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0454"
FT   CDS_pept        complement(523867..526068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05920"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15419"
FT                   /db_xref="GOA:A0A0H2ZLD9"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD9"
FT                   /protein_id="ABJ15419.1"
FT                   /translation="MPPSSLTHTLRRLWALDKFAYSLRVFIALAGALLLCWWQDRIELL
FT                   IPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPYPWLFVSGMALSAF
FT                   GMILLGALGERYAAIASATLILSIYTMIGVDQRGGEVADVWHEPLLLVAGAAWYGLLSV
FT                   LWNALFSNQPVQQSLSRLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKVVVAL
FT                   NQAKETILNRLGHGRPGPKVSRYLKLYFIAQDVHERASSSHYPYNRLAEAFFHSDVLFR
FT                   CQRLLNQQGKACQALARAIRLRQPFDYADRELALEDLQASLEHLRQQSNPAWKGLLRSL
FT                   GALAANLTTLDRKLAGASNPDAIADEQDSALLDRSPRSLKDAFERLRQQLTPTSLLFRH
FT                   GLRMALALTAGYGVLHWIHPTQGYWILLTTVFVCQPNYGATRLRLVQRILGTVVGLVVG
FT                   WALIDLFPSPLVQSLFAVAAGVAFFATRSSRYTLATAAITLLVLFCFNQVGDGYGLILP
FT                   RLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLRQIMQQYATGKRDDLD
FT                   YRTARRNAHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLSHTLLSYLSGLGAHRES
FT                   LPEDASDGLLERAAERLSASLEEIAASLEQKRPVAIYSEEEEALAKELEQMPEDMDDSH
FT                   RLVQTQLAHICRQLAPLRTLAAHLLKKELAGAQPLPGQP"
FT   gene            complement(526330..527706)
FT                   /gene="dbpA"
FT                   /locus_tag="PA14_05950"
FT   CDS_pept        complement(526330..527706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PA14_05950"
FT                   /product="RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15420"
FT                   /db_xref="GOA:A0A0H2ZKL6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL6"
FT                   /protein_id="ABJ15420.1"
FT                   /translation="MTSTAFSSLPLSADLLANLDSLGYREMTPIQAQSLPLILQGHDLI
FT                   AQAKTGSGKTAAFGLALLSPLNPRYFGCQALVLCPTRELADQVAKEIRRLARAADNIKV
FT                   LTLCGGVPYGPQVASLEHGAHVVVGTPGRIQEHLRKGTLVLDGLNTLVLDEADRMLDMG
FT                   FYDSIAEIIGQLPERRQTLLFSATYPDGIEKLAKTFMRDPRQVKVESLHADSQIEQRFF
FT                   EIDPKQRMDAVVRLLQHFRPQSCVAFCQTRQQCQELADALKAQRISALALHGDLEQRER
FT                   DQVLTVFANRSCNVLVATDVAARGLDIAALETVINVELARDPEVHIHRIGRSGRAGEKG
FT                   LALSLVAPAEASRAQAIEDLQKQPLAWYALGQLKASPEPLLPPMSTLCIAGGRKDKVRP
FT                   GDLLGALTGDAGLPGSAVGKIAIFDFQAFVAIERGLAHQALKRLSEGKIKGRSFKVRLL
FT                   "
FT   gene            528054..528263
FT                   /gene="cspB"
FT                   /locus_tag="PA14_05960"
FT   CDS_pept        528054..528263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspB"
FT                   /locus_tag="PA14_05960"
FT                   /product="putative major cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15421"
FT                   /db_xref="GOA:A0A0H2ZK92"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK92"
FT                   /protein_id="ABJ15421.1"
FT                   /translation="MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLAE
FT                   GQKVSFEVVQGQKGMQAERVQVIN"
FT   gene            528414..528938
FT                   /locus_tag="PA14_05970"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0457"
FT   CDS_pept        528414..528938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15422"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL74"
FT                   /protein_id="ABJ15422.1"
FT                   /translation="MKPVQSRRLAFAALLSLSFSSASCHAATEHWGWIEQSWLMPERMQ
FT                   AKAKLDTGALTSSLDARNIHRYKKDGERWVRFDVVLPTADSKAPVSVTFERKVLRLIKV
FT                   RGAGGSDSRPVVAMDICLGAKLLREQFSLRDRGNMNYPVLLGRRTLEHLGAVDVSRTFT
FT                   RKPTCSALAAQ"
FT   gene            complement(529041..530474)
FT                   /gene="emrA"
FT                   /locus_tag="PA14_05990"
FT   CDS_pept        complement(529041..530474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="PA14_05990"
FT                   /product="putative drug resistance transporter, EmrB/QacA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15423"
FT                   /db_xref="GOA:A0A0H2ZL03"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL03"
FT                   /protein_id="ABJ15423.1"
FT                   /translation="MSEPFQLTPRIARQLPWLVAVAFFMQALDGTILNTALPSMASSLN
FT                   ENPLRMQAVVIAYLLTVALLIPASGWIADRFGTRRVFLGAVLLFSLGSLLCALSPSLEL
FT                   LVGARIVQGVGGALMMPVGRLVILRVYPRQDLVRVLSFVTIPGLLGPLAGPTLGGWLVE
FT                   YASWHWIFLINLPVGLLGCLVAMKLMPDLRSPVPSRFDSIGFLLFGGSMVLISIALEGL
FT                   GELHLSHLRVVLLLIGGLVLLTAYWLRALRIDKPLFPPSLFKARTFAVGILGNLFARLG
FT                   SGALPFLTPLLLQVGLGYPPSTAGMTMIPLALFAMVAKPMAKPLLDFFGYRKLLVGNTL
FT                   ILGCLIAGFGLVDQDTPYVWLLLHLSLLGAVNSLQFTAMNTLTLIDLQDSNASSGNSLM
FT                   SVVVQLSISLGVACAAALLGGFQTDLDTGQDTVLGAFHATYVSVGLMSMLAAAIFFQLG
FT                   SEDGRTSPRRVDPEKDPDL"
FT   gene            531095..533647
FT                   /gene="clpA"
FT                   /locus_tag="PA14_06000"
FT   CDS_pept        531095..533647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="PA14_06000"
FT                   /product="putative ClpA/B protease ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15424"
FT                   /db_xref="GOA:A0A0H2ZLE4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE4"
FT                   /protein_id="ABJ15424.1"
FT                   /translation="MDIAEYFSKQTTEYLQRAAQVAAEFGKREVDTEHLLYALADADVV
FT                   QAVLKQFGLSPADLKQYIEANAVRGASKGEASEDMTISPRVKSALQHAFALSRELGHSY
FT                   VGPEHLLLGLAAVPDSFAGTLLKKYGLTEQALRQKAVKVVGKGAEDGRVDGPSNTPQLD
FT                   KFSRDLTRLAREGKLDPVIGRSKEVETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQ
FT                   RMVQGEVPEVLRDKRLVELNINAMVAGAKYRGEFEERLKQVMDELQAAQSEIILFIDEV
FT                   HTIVGAGQGGGEGGLDVANVLKPAMARGEMNLIGATTLNEYQKYIEKDAALERRFQPVF
FT                   VPEPTVEQTISILRGLRDKLEGHHKVTIRDEAFVAAAELSDRYIGNRFLPDKAIDLIDQ
FT                   AAARVRIASTSRPAEIQELEAELAQLKREQDYAASRKWYDEAKVFEKRIQERKEHLEQI
FT                   TERWQQTQGSKTEEVRVEDIAEIISKLTGIPVTELTAEEREKLLQMEERLHQRVIGQQE
FT                   AITAVSDAVRLARAGLRQGSRPIATFLFLGPTGVGKTELAKALAEVVFGDEDAMIRIDM
FT                   SEYMERHAVSRLIGAPPGYVGYDEGGQLTERVRRRPYSVILLDEIEKAHADVNNILLQV
FT                   FDDGRLTDGKGRVVDFTNTIIIATSNLGSELIMKNAQAGEFAQPPEKLKRELMTTLRGH
FT                   FRPEFLNRLDEVIVFESLSKAQIEDIVRLQLERVKRAAHAQDIYLHIDDSLVGHLAEEA
FT                   YQPEFGARELKRQIRQQLETRLATAMLKGEVKEGETVTFFYDAKDGVGYRKGAAPKPAA
FT                   RKKSGAGETPKGRATAARKPAAKKGAAAKGKADKPKTK"
FT   gene            533749..534327
FT                   /locus_tag="PA14_06010"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0460"
FT   CDS_pept        533749..534327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15425"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM0"
FT                   /protein_id="ABJ15425.1"
FT                   /translation="MRVTTHATLAAALLLSAASAFAFNLGDAAKAVAGASQGDSAQVAT
FT                   TPQTSGLLGALTGQLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLAGNN
FT                   ALAGLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTLGMDSGMTEKFAQVLVDY
FT                   FGKQGANSELLGSLSNLWGVSKAGGSSLL"
FT   gene            complement(534444..535331)
FT                   /locus_tag="PA14_06030"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0461"
FT   CDS_pept        complement(534444..535331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06030"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15427"
FT                   /db_xref="GOA:A0A0H2ZL80"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL80"
FT                   /protein_id="ABJ15427.1"
FT                   /translation="MRELLTGLTSSLLLLLNTLILIGPMMLIALLKLVLPGQRLKDLCS
FT                   RGVMWIAETWAEIDKWIFATCTPTVWDVRGAGDLRQDTSYLVVSNHQSWVDIPALIQVF
FT                   NRRTPYFKFFLKKELIWVPFLGLAWWALEYPFMKRYSKAFLEKHPELKGKDLEITKAAC
FT                   EKFKRIPVTVVNYLEGTRFSEQKKARQQSPYRHLLKPKAGGVAFVLAALGEQLDALLDV
FT                   TVVYPSDKVPGFWDLLCGRVPKVIVDIQTRPIDPALWQGDYENDPVFRQYVQEWVSRMW
FT                   EEKDERIARLRQLR"
FT   gene            535279..535983
FT                   /locus_tag="PA14_06040"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0462"
FT   CDS_pept        535279..535983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15426"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK97"
FT                   /protein_id="ABJ15426.1"
FT                   /translation="MLRSSRRLLVRPVNSSRMVGFPVLGVGRRGPSYASAPRRPSRRRG
FT                   ERNRAVLVLCGPRITSGDARVKRALALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQ
FT                   AKMDTGAYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNR
FT                   NGEDEDEDRLSERPVIDLQVCLGGAMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDP
FT                   SERFVADKPTCK"
FT   gene            536068..536757
FT                   /gene="creB"
FT                   /gene_synonym="blrA"
FT                   /locus_tag="PA14_06060"
FT   CDS_pept        536068..536757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creB"
FT                   /gene_synonym="blrA"
FT                   /locus_tag="PA14_06060"
FT                   /product="two-component response regulator CreB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15428"
FT                   /db_xref="GOA:A0A0H2ZL08"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL08"
FT                   /protein_id="ABJ15428.1"
FT                   /translation="MPHILIVEDEAAIADTLLYALQAEGFATTWVTLAGEALVLQERQP
FT                   ADLLILDVGLPDISGFEACKRLRRFSEVPVIFLTARDAEIDRVVGLEIGADDYVVKPFS
FT                   PREVAARVKAILKRMAPRPAALEEAAPSGPFQVDEERVRIHYRDTPLNLTRHEFRLLQT
FT                   LLGQPERVFSREQLLDALGVASEAGYERNIDSHIKSLRAKLRQVNERGEAIQTHRGLGY
FT                   SYSPDHA"
FT   gene            536757..538181
FT                   /gene="creC"
FT                   /gene_synonym="blrB"
FT                   /locus_tag="PA14_06070"
FT   CDS_pept        536757..538181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /gene_synonym="blrB"
FT                   /locus_tag="PA14_06070"
FT                   /product="two-component sensor CreC"
FT                   /note="catabolite repression sensor kinase for PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15429"
FT                   /db_xref="GOA:A0A0H2ZLE9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE9"
FT                   /protein_id="ABJ15429.1"
FT                   /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVDT
FT                   ANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASGKV
FT                   LLDSAGVAVGQDYSRWNDVYLTLRGQYGARSSREDPDDPDSSVMYVAAPIKDAGKIIGV
FT                   VSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTQYAQAVSE
FT                   GRRAELPRYRGGEMAQLADAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRGAAELL
FT                   DGEMPAEQRARFVGNIAGESERLQQLIERLLSLAQVEQRQGLEEVGKVDLREIAASLLE
FT                   GQAARIQRQRLRVENRLEGPCEVRGEQFLLRQALANLLDNALDFTPPGGILRLLAEADG
FT                   EGIALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQLHGGRLQV
FT                   GNRDDGVEALLWLPRG"
FT   gene            538283..539641
FT                   /gene="creD"
FT                   /gene_synonym="blrD"
FT                   /locus_tag="PA14_06080"
FT   CDS_pept        538283..539641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creD"
FT                   /gene_synonym="blrD"
FT                   /locus_tag="PA14_06080"
FT                   /product="inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15430"
FT                   /db_xref="GOA:A0A0H2ZKM3"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM3"
FT                   /protein_id="ABJ15430.1"
FT                   /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEVRDGVLQDIA
FT                   RSSSYSQRLTGPLLVVPYRRTVREWVTEEKTEKRVLQEREQRGELYFLPDRFALDGQMR
FT                   TELRYRGIYQARLYHVDNKVAGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGIENA
FT                   LRLSLNGASVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLSLLGSERLDIVPV
FT                   GRDSQVILKADWPHPSFGGEFLPSEREITAQGFTARWQTSFFATNMEEALRSCVEEQRC
FT                   DGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHPIQYALV
FT                   GLALAFFYLLLLSLAEHVGFELAYLVSAGACVGLIGFYLCFVLRSVARGLGFSAGLAGL
FT                   YGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDLPAVPDRA"
FT   gene            539691..539993
FT                   /locus_tag="PA14_06090"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0466"
FT   CDS_pept        539691..539993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15431"
FT                   /db_xref="GOA:A0A0H2ZKA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA2"
FT                   /protein_id="ABJ15431.1"
FT                   /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPLA
FT                   HAMLVLMPDGFWEGLSGIEGAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
FT   gene            complement(540138..540758)
FT                   /locus_tag="PA14_06120"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0467"
FT   CDS_pept        complement(540138..540758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06120"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15432"
FT                   /db_xref="GOA:A0A0H2ZL85"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL85"
FT                   /protein_id="ABJ15432.1"
FT                   /translation="MSATHTLFYAAASPFVRKVLVLLHETGQRERVALEEVTPTPVAPI
FT                   RQLNASNPAGKIPALRLPDGQVLHDSRVICDYFDQQHVGEPLIPREGSARWRRLTIASL
FT                   ADAVLDAAVLTRYETFVRPEEKRWDAWLEAQREKIARSLAWLESDCIAELQARFDIAAI
FT                   GVACALGYLDLRQPEWDWRGRYPRLAAWFAEVSQRPSMQATRA"
FT   gene            complement(540777..541727)
FT                   /locus_tag="PA14_06130"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0468"
FT   CDS_pept        complement(540777..541727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06130"
FT                   /product="putative streptogramin lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15433"
FT                   /db_xref="GOA:A0A0H2ZL12"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL12"
FT                   /protein_id="ABJ15433.1"
FT                   /translation="MRHLPYPLLGLLLALSSTGAALAGEQYYPLDKGSAPYAVAPSAQG
FT                   AVWYGADGGHSLGRLDPTSGESVQVPLGEGARPRAIVSDESGNAWVLDSGLNAILRIGG
FT                   ERLGSERFPLPAKAAPAGLESAVFDDDGRLWFTGSRGFHGRLDPARRLVEVWPSPQGKA
FT                   ANGICVTPDGEVWYAQDDALVHVDPLDGSAERLPAPEGTKALRGIGADSIGRLWASDSG
FT                   GARLYRYDPSDASWQSWPLPDSQARPDSLRVDAMDRVWLHDAASGALLRFDSEQATFRV
FT                   LPSDRPAPGNALLGGRPGETWSAEPAADRLRVVRD"
FT   gene            541813..542670
FT                   /locus_tag="PA14_06150"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0469"
FT   CDS_pept        541813..542670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15434"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF5"
FT                   /protein_id="ABJ15434.1"
FT                   /translation="MATVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLGV
FT                   ESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMPAA
FT                   CLSLLRIRGGEIELLNIGDSRILVEGADGQVRSFGDSALYELDRQSLAHFCRMREEHPQ
FT                   WDHAELFKASRPRVRQNRLLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVLMTDG
FT                   FDRLVEPFRRYTDEQLLRRLEDVGVSAMLDELREIEQGDDQALAFPRFKIHDDASALWG
FT                   RIAG"
FT   gene            complement(542843..545236)
FT                   /gene="fiuA"
FT                   /locus_tag="PA14_06160"
FT   CDS_pept        complement(542843..545236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fiuA"
FT                   /locus_tag="PA14_06160"
FT                   /product="putative hydroxamate-type ferrisiderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15435"
FT                   /db_xref="GOA:A0A0H2ZKM8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM8"
FT                   /protein_id="ABJ15435.1"
FT                   /translation="MPRPTFRPGLLALAIALAVPAPFLHAAPAEQASVRDYRIAAGPLA
FT                   GTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALKGSGLELVENAGGTYS
FT                   LRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISVATRQQ
FT                   MTDRAVHNLDDAVRYMPGVVASSFGSDTRSDWLKVRGFKPTQFLDGLPMAVGVYNNPKL
FT                   ETWNLERVALLRGPASSVYGQTPPGGMLDMVSLRPQNVTSHEVKAEVGNYNHKQVSFDS
FT                   TGPLDDEGRFLYRISGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTFLGQFNRDD
FT                   TGITSQFLPLRGTKYDAPFGKVSHHKNLGDPDWEYYDRTYYWLGYAFERRINDVWQFRQ
FT                   NLRYLRNDLSFQAVTAGTAHADGTLERSTTSVDEDVSQFVVDNNFQADFETGALRHTLL
FT                   LGLDHNRTDNQYTSIFGSAPPSNVNNPIYGQPIVKPDRSTAFYDYKQKTYQTGLYVQDQ
FT                   IALDNWRLTLGGREDWVHTGATFYNKGDATNTSRDKKFSGNAALSYIFDNGVAPYISYA
FT                   ESFQPTTGADMNSTSSLKPTEGKQWEIGVKYQPVGSDSLFTAAVYDLRQENVSVSQNIG
FT                   GTPVTSQTGEVKVSGIELEATSNVTDNLKLIGAYSYADTEVKKGQYAGNRLQQAPRNQA
FT                   SLWADYTWHEGALNGFSVGAGARYVGSTYGDQANTYDGYAGSYTLYDAAVRYDLGQLNG
FT                   SLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSVVGSVSYKW"
FT   gene            complement(545340..546311)
FT                   /gene="fiuR"
FT                   /locus_tag="PA14_06170"
FT   CDS_pept        complement(545340..546311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fiuR"
FT                   /locus_tag="PA14_06170"
FT                   /product="putative transmembrane sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15436"
FT                   /db_xref="GOA:A0A0H2ZKA7"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA7"
FT                   /protein_id="ABJ15436.1"
FT                   /translation="MSADDRHSPVRARVLDEAIAWQLLLDSGEAHPDDHRAFHRWYAAH
FT                   PEHERAWEQLGGLDRHLARAANGPARNALLSGNARFKRRLRRLGGSALGLVLALGVGLG
FT                   VANRYVPVRYLLADAYSATGEQRELTLPDATHVRLNSRSAIDVRFDGERRQVVLLAGEI
FT                   LVETAHGDPRPFVVSSADGDMRALGTRFLVRREEPGTRLTVLQSAVAARAETLSEERVI
FT                   KEGQQVLILPQGLRASEAAPALAGAWAQGMLVVENARLADLVAELGRYSPALLRVDPSI
FT                   ADLRVTGSFPLKDTRLALQALEPSLPVRSVRHNAWWFEVVPR"
FT   gene            complement(546308..546826)
FT                   /gene="fiuI"
FT                   /locus_tag="PA14_06180"
FT   CDS_pept        complement(546308..546826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fiuI"
FT                   /locus_tag="PA14_06180"
FT                   /product="putative RNA polymerase sigma-70 factor, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15437"
FT                   /db_xref="GOA:A0A0H2ZL90"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL90"
FT                   /protein_id="ABJ15437.1"
FT                   /translation="MSAGDVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTF
FT                   VRLLGRPELPGLREPRAFLAKVARGLMIDHFRRAALEQAYLAELALVPEAEQPSAEEQY
FT                   LILEDLREIDRLLGTLSLKARSAFLYSRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQC
FT                   YIALYGEPR"
FT   gene            546995..547744
FT                   /gene="psfA"
FT                   /locus_tag="PA14_06190"
FT   CDS_pept        546995..547744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psfA"
FT                   /locus_tag="PA14_06190"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15438"
FT                   /db_xref="GOA:A0A0H2ZL17"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL17"
FT                   /protein_id="ABJ15438.1"
FT                   /translation="MAEPLLIIGSYLSPYVRKVLVLLELKGIAYRIDPIVPFFGDEAFE
FT                   RLSPLRQIPVLVDGDFVLNDSSVICQYLEERYPQPSLYPADIGQRAQARWLEEYADSRL
FT                   GQVIIWQLFHQLVINRGIWHREPDQAILQRTYDEDLPSICNYLEGRVPPSGWLCGELSI
FT                   ADVAVACLFRNAQLARYQVDGERWPRLARLLADAFALPAFQHLARFEKATAQTPVAEQR
FT                   QALREAGAPLSATSHARERPVRGPMSR"
FT   gene            547884..548288
FT                   /locus_tag="PA14_06200"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0474"
FT   CDS_pept        547884..548288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06200"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15439"
FT                   /db_xref="GOA:A0A0H2ZLF9"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF9"
FT                   /protein_id="ABJ15439.1"
FT                   /translation="MMNVPEGFQPLFRSSPLLDLLGPFFCRHDAQRQLVVALRIDEKHC
FT                   NHGGTAHGGLLSTLADVGLGYAMAFSREPPQPMVTVGLRLDFCGVARVGDWLEVHTRVD
FT                   KLGQRMAFASARLHSGERLVASASGVFHLP"
FT   gene            548338..548907
FT                   /locus_tag="PA14_06210"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0475"
FT   CDS_pept        548338..548907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06210"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15440"
FT                   /db_xref="GOA:A0A0H2ZKN2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN2"
FT                   /protein_id="ABJ15440.1"
FT                   /translation="MPKKSNAAERIVHATASLLASRGYFGTGLSDIIARAEAPKGSLYH
FT                   YFPEGKPQIASAAIGFVADEVASFLDRAGTQAPHARNVLRQFTATLRGWLEHSRFEEAC
FT                   PVLSTSLSIDAELAPVHAECRRALRAWHASIERALRADGLAEKLAASRAWLILAALEGA
FT                   VAVARVERSFQALDAIEEELQALLPA"
FT   gene            complement(548941..550668)
FT                   /locus_tag="PA14_06230"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0476"
FT   CDS_pept        complement(548941..550668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06230"
FT                   /product="putative cytosine/uracil/thiamine/allantoin
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15441"
FT                   /db_xref="GOA:A0A0H2ZKB3"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB3"
FT                   /protein_id="ABJ15441.1"
FT                   /translation="MSSTPKPPASPREFSPSLLDLGTLESLDSLPRAGQRSAEFSASLL
FT                   DLGTPASLDCLPRAGLRAAEFSAARLDLGTPASLDCLPRASHHAGTELPPLSPRLYSAD
FT                   LAPTKAEGRRWGRYSLFALWTNDVHNIANYSFAIGLFALGMSGAQILAALALGALMVYG
FT                   LMNLSGYMGQKTGLPYPVMCRIAFGIHGAQLPALIRAVIAIAWFGIQTYLASIVLRVLL
FT                   TAIWPGLAAYDQDAILGLSSLGWATFVAIWCVQLLIFAYGMEMVRRYESFAGPVILLTV
FT                   AALAAWMYLRAGASIAWSSGEPMSGSQMWLKIFGGAAFWVTLYGTMILNFCDFARGCPD
FT                   RRTISVGNFWGLPVNILLFGLFAVVLAGAQFRIDGQLIQSPTDIVAAIPDTLFLVLASL
FT                   ALLIVTVAVNIMANFVAPAYVLTNLAPNLLNFRRAGLISATIAVLILPWHLYNSPGVIL
FT                   YFLGGLGALLGPLYGIIMVDYYLVRKGRVNLPELYTESRAGAYHYARGVNPRAIAAFVP
FT                   AAIISTLLALLPAFAELSPFSWFFGAGLAGLIHYALAKRRTAYREVSGEAIAVDSVQH"
FT   gene            complement(551016..551942)
FT                   /locus_tag="PA14_06240"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0477"
FT   CDS_pept        complement(551016..551942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06240"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15442"
FT                   /db_xref="GOA:A0A0H2ZL97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL97"
FT                   /protein_id="ABJ15442.1"
FT                   /translation="MHPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGR
FT                   LRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFA
FT                   ATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLP
FT                   EGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSG
FT                   LRREVAVQLPTVLAALFLAGSTDFLLTAPRHAAQALAEAAGLALYPAPFDIPPYVLRLY
FT                   SHVQHVGRDAHAWMIGQLKGLDIFRTG"
FT   gene            552030..552506
FT                   /locus_tag="PA14_06250"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0478"
FT   CDS_pept        552030..552506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06250"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15443"
FT                   /db_xref="GOA:A0A0H2ZL23"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL23"
FT                   /protein_id="ABJ15443.1"
FT                   /translation="MTLEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSLF
FT                   AEGSPTRALMCLSEGRPIGYAVYFYSYSTWLGRNGIYLEDLYVTPEYRGVGAGRRLLRE
FT                   LAREAVANDCGRLEWSVLDWNQPAIDFYRSIGALPQDEWVRYRLDGEALRKMAE"
FT   gene            complement(552585..553523)
FT                   /locus_tag="PA14_06260"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0479"
FT   CDS_pept        complement(552585..553523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06260"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15444"
FT                   /db_xref="GOA:A0A0H2ZLG4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLG4"
FT                   /protein_id="ABJ15444.1"
FT                   /translation="MHDFTLHDLQCFDAVVDAGGFQAAAQRLHRSHPAVFAAVARLERQ
FT                   LGLVLLERGGYRVGLTAAGRAFHQRAQALLYELEGLRGHAAHLAQGEESELRVVLGDLC
FT                   PPRPALALLAGFFGSQPQTRLQLLFETVSGPLERLLDGEADLILHRVDKSDPRLEWLDL
FT                   CRVGLVPVIAPGLLGDPPPRPVRPEQLRPFAQCVMRDSARHSPPTDYFMLAGARQCSVP
FT                   DQRTKKEMILQGLGWGHLPDFLVDEELADGRLLALAGPHLPGRSEEVVAARRRDRAQGP
FT                   VAERLWAFLRDNATTLRGKSGDRAEGARRPR"
FT   gene            553627..554424
FT                   /gene="catD"
FT                   /locus_tag="PA14_06270"
FT   CDS_pept        553627..554424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catD"
FT                   /locus_tag="PA14_06270"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15445"
FT                   /db_xref="GOA:A0A0H2ZKN7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN7"
FT                   /protein_id="ABJ15445.1"
FT                   /translation="MGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQL
FT                   PALTRHFRVLRYDARGHGASSVPPGPYTLARLGEDVLELLDALEVRRAHFLGLSLGGIV
FT                   GQWLALHAPQRIERLVLANTSAWLGPAAQWDERIAAVLQAEDMSDTAAGFLGNWFPPAL
FT                   LERAEPVVERFRAMLMATNRHGLAGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTAA
FT                   SHGELIATSIAGARLVTLPAVHLSNVEFPQAFEGAVLSFLGAA"
FT   gene            554467..554910
FT                   /locus_tag="PA14_06280"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0481"
FT   CDS_pept        554467..554910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB8"
FT                   /protein_id="ABJ15446.1"
FT                   /translation="MNEPGSFIWTWYGQDEHRWVLLSAEAFLALDFLALDGAMQRETIG
FT                   SCPGCSTWSEKIVPLHEWLEGCPGHQAGNFRDALRRVWALCNELPEEALGCFDFDIYAH
FT                   PGWQAVRREAREALRQNGWDSIRSHAEELRDDCWERVHGYPKK"
FT   gene            complement(554958..557135)
FT                   /gene="glcB"
FT                   /locus_tag="PA14_06290"
FT   CDS_pept        complement(554958..557135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="PA14_06290"
FT                   /product="malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15447"
FT                   /db_xref="GOA:Q02TT1"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TT1"
FT                   /protein_id="ABJ15447.1"
FT                   /translation="MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVIND
FT                   LAPKNKALLAKRDELQAKIDGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQN
FT                   VDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKV
FT                   RGDKVIAFARAFLDEAAPLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQ
FT                   GDAAKPQAVLLKHNGLHFEIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVD
FT                   ADDKVVIYRNWLGLMKGDLAEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVR
FT                   NVGHLMTNDAILDKDGNEVPEGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMH
FT                   GPEEAAFTNELFGRVEDVLGLPRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGF
FT                   LDRTGDEIHTSMEAGAVVRKGAMKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMP
FT                   DLMAAMLEQKIGHPLAGANTAWVPSPTAATLHALHYHKVDVFARQAELAKRTPASVDDI
FT                   LTIPLAPNTNWTAEEIKNEVDNNAQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATL
FT                   RISSQLLANWLRHGVISQEQVVESLKRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAAL
FT                   ELVVEGTRQPNGYTEPVLHRRRREFKAKNGL"
FT   gene            557442..557885
FT                   /locus_tag="PA14_06300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0483"
FT   CDS_pept        557442..557885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06300"
FT                   /product="putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15448"
FT                   /db_xref="GOA:A0A0H2ZLA2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA2"
FT                   /protein_id="ABJ15448.1"
FT                   /translation="MPVHAASLADLADLVPLFSAYLDFYEVPAPEEQVRAFLAERLRQG
FT                   DSTLFLARDAEARALGFVQLYPLFASLALRPSWLLSDLYVRPEARRQGVGEALMNQARG
FT                   FAESMGACGLQLETAKTNHAGQSLYERLGYVRDEQFYTYWLQL"
FT   gene            557917..558432
FT                   /locus_tag="PA14_06310"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0484"
FT   CDS_pept        557917..558432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06310"
FT                   /product="putative ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15449"
FT                   /db_xref="GOA:A0A0H2ZL27"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL27"
FT                   /protein_id="ABJ15449.1"
FT                   /translation="MDHLVLTVIATDHPGLVERIAQCIASHGGNWLESRMSRMAGQFAG
FT                   ILRVAVPAEGYDELVEGLQGLSSHGIRVLLAESGIEPVCNWKPIHLDLVGNDRPGIVRD
FT                   ITRLLAEHGVNLESLSTEVRPAPMSSEPLFHADALLAVPLTLSLDTLRERLEDLADDLM
FT                   VELVLDAS"
FT   gene            complement(559121..560017)
FT                   /gene="rarD"
FT                   /locus_tag="PA14_06320"
FT   CDS_pept        complement(559121..560017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="PA14_06320"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15450"
FT                   /db_xref="GOA:A0A0H2ZLG9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLG9"
FT                   /protein_id="ABJ15450.1"
FT                   /translation="MATANLRRGYVLGLTAYVIWGLFPLYFKLLERIPAVEIIVQRAVW
FT                   SALFGAVLLLFWKHPGWWRELRQNPQRFVVLAASGLLIASNWMTYVWAVNNGHMLEASL
FT                   GYYINPLINVMLGMLLLKERLRPLQWLAVALASLGVAQQVWQLGSLPWVSLVLALTFGF
FT                   YGLIRKKAPVAALPGLVVETWLLLPLALVWLLLFADGPTSETAFWSTPEALWVVAAGPV
FT                   TLVPLVCFNAAARHLPYATLGFLQYLAPTLVLLQAILLFGEHLDSSRLTAFAFIWLALA
FT                   VYSFDAWRSLRRLPQPG"
FT   gene            complement(560220..561194)
FT                   /locus_tag="PA14_06330"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0486"
FT   CDS_pept        complement(560220..561194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06330"
FT                   /product="putative putative homoserine kinase type II"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15451"
FT                   /db_xref="GOA:A0A0H2ZKP1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP1"
FT                   /protein_id="ABJ15451.1"
FT                   /translation="MSHPFDQLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIED
FT                   GEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLSRDGESLFAFAGFRFALFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALAVDNFGHASLATLLEGNFI
FT                   PRSLLPAYESVARDLLKRLDALFAEVPYQPIRLHGDCHPGNLLCRDEVYHMVDLDDCRM
FT                   GPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHYSAWLA
FT                   RRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
FT   gene            complement(561256..562014)
FT                   /gene="modR"
FT                   /locus_tag="PA14_06340"
FT   CDS_pept        complement(561256..562014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modR"
FT                   /locus_tag="PA14_06340"
FT                   /product="putative molybdenum transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15452"
FT                   /db_xref="GOA:A0A0H2ZKC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC2"
FT                   /protein_id="ABJ15452.1"
FT                   /translation="MSALSTLAQHVTRRPQRIALLAQIAELGSITRAAKAVGISYKGAW
FT                   DAIDELNNLAERPLVERSVGGKGGGGARLTAEGERLLALYRRLEALQAQVLQAAEDAED
FT                   LNLIGRLMLRTSARNQLHGRVLSIHGEGFHDRIAIELPGQQRIEALITRASTEQLELGR
FT                   GRPVLALIKAGWLDVGLEPREDQPNQLHGTLEEILAAKAGPSEVRIALGSGLTLCALLS
FT                   GERLASLGLKKGQKVIASFDPAQVLLGTPL"
FT   gene            complement(562082..562402)
FT                   /gene="yfiM"
FT                   /locus_tag="PA14_06350"
FT   CDS_pept        complement(562082..562402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiM"
FT                   /locus_tag="PA14_06350"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15453"
FT                   /db_xref="InterPro:IPR017028"
FT                   /db_xref="InterPro:IPR018736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA7"
FT                   /protein_id="ABJ15453.1"
FT                   /translation="MRALLVVACLLLGGCSHFAEDDWLGEDKALHFASSAALTAAGMQM
FT                   AHDRGLHGARQARFGLSFSLAFGVGKELYDSRSAGSGWSWKDLAWDLAGAAAGYGLYQA
FT                   AE"
FT   gene            complement(562444..563169)
FT                   /gene="comF"
FT                   /locus_tag="PA14_06360"
FT   CDS_pept        complement(562444..563169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="PA14_06360"
FT                   /product="putative phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15454"
FT                   /db_xref="GOA:A0A0H2ZL31"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL31"
FT                   /protein_id="ABJ15454.1"
FT                   /translation="MSFPLRPLTRWLLPPPACLLCAARSDQPPRPLCRACAADLPWSRQ
FT                   QCRRCALPLPLDGQVCGECLRRPPAYEQAIAPWRYAFPLDSLINRFKHQAAWPLGRLLG
FT                   ELLAEHLRQRYAEGLPRPARLLPVPLAPRRERRRGFNQAQQLAERLAGELDLRSDPHSL
FT                   RRVLDTPAQQGLDATVRRRNLRHAFALAPASDVRGLHLALVDDVLTTGATAECLSRLLR
FT                   RAGAARVDVYCLARTPKPG"
FT   gene            complement(563308..563601)
FT                   /locus_tag="PA14_06390"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0490"
FT   CDS_pept        complement(563308..563601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15455"
FT                   /db_xref="GOA:A0A0H2ZLH5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH5"
FT                   /protein_id="ABJ15455.1"
FT                   /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWGAMDDFLHGLAR
FT                   AIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIVGGVIWTVLGLIVMSWLIH"
FT   gene            complement(563655..564581)
FT                   /locus_tag="PA14_06400"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0491"
FT   CDS_pept        complement(563655..564581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06400"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15456"
FT                   /db_xref="GOA:A0A0H2ZKP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP6"
FT                   /protein_id="ABJ15456.1"
FT                   /translation="MLPMALTLRQVRYFIATAEFGQISQAAIHLNISQSAVTSAIQELE
FT                   GMLGVALFTRTAQGMNLTDSGRHFLNHAYSIQRSVDDALNSPQPDTRVDGTLKVAASYT
FT                   VMGYFLPHHLQRLAQWYPELELQLFEDERASIERGLLDGRYDIAVLLTGNLTEPGIAAE
FT                   TLFNSERRLWLPSRHPLGEKADLGLADVAGEPYIMLTVDEAGQSALRYWQQSGHRPQVI
FT                   LHTSSVEAVRSMVANGSGVAILSDLVYRPWSLEGKRIETLSLVDPVPSMSVGLAWRRDT
FT                   EASAGMRAFREYFRQSFLAPQQSSSRR"
FT   gene            564699..565457
FT                   /locus_tag="PA14_06420"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0492"
FT   CDS_pept        564699..565457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06420"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15457"
FT                   /db_xref="GOA:A0A0H2ZKC5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC5"
FT                   /protein_id="ABJ15457.1"
FT                   /translation="MTEVDFNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDP
FT                   SSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQ
FT                   GLSLQHVKPHGALYMHLARDEAAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPL
FT                   VREFYADRDYDRSGSIVFTRRVAALDPQQVADKVLRACREGKVRTVEGEDLDIAFDSVC
FT                   IHSDTPGALELVASTRARLEGAGIRIKAPR"
FT   gene            565534..565782
FT                   /locus_tag="PA14_06430"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0493"
FT   CDS_pept        565534..565782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06430"
FT                   /product="putative biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15458"
FT                   /db_xref="GOA:A0A0H2ZLB5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB5"
FT                   /protein_id="ABJ15458.1"
FT                   /translation="MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVMK
FT                   QFSEVQAGQAGILQAFHVEDGEAIEPGQVLAVIASAT"
FT   gene            565793..567169
FT                   /gene="accC"
FT                   /locus_tag="PA14_06450"
FT   CDS_pept        565793..567169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="PA14_06450"
FT                   /product="putative acyl-CoA carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15459"
FT                   /db_xref="GOA:A0A0H2ZL34"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL34"
FT                   /protein_id="ABJ15459.1"
FT                   /translation="MHKRLNKLLVANRGEIAVRIIRAAQALGIPTVAVCSEADRDSLAA
FT                   RLADEVRLIGPARAERSYLDIEAILMAARETGADSIHPGYGFLSENPAFAEAVQAAGLV
FT                   FVGPDAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELDDLDAALACAEEVGYPLLVKAS
FT                   AGGGGRGIRIAHDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILGDGER
FT                   AVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTLEYLFD
FT                   AHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEDIRLNGAALEM
FT                   RINAEDPARNFFPSPGTVERLEWPQGEGVRVDSHLYPGYRVPPYYDSLLAKLIVHGRDR
FT                   DEAFARARQALERTVLAGMATTLPLHRWLLADARVQAAQFDTATLETWLAERTAAAQEV
FT                   "
FT   gene            567171..568049
FT                   /locus_tag="PA14_06460"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0495"
FT   CDS_pept        567171..568049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06460"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15460"
FT                   /db_xref="GOA:A0A0H2ZLI0"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLI0"
FT                   /protein_id="ABJ15460.1"
FT                   /translation="MHANIRYSFGGDEHLFAEVAEAMSLEAFFRGMAITRAIEALQLPG
FT                   VLDVCLANASFQVRFDPDRLAPEALLETVRGLEAEAVAARSIETRIVEVPVLYNDPWTH
FT                   ETLMRFRDRHQDPDSTDLEYAARINGYADVQAFIQAHSGTPWFVSMVGFVAGLPFMYQM
FT                   VERERQLQVPKYLRPRIDTPKLTLGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPRQGL
FT                   PYLEESMVFFRAGDIVQFRPIERTEYERMAAEVEAGTFDLRIRPVSFDLDAFLADPRGC
FT                   TQRLQEVLYVD"
FT   gene            568039..569016
FT                   /locus_tag="PA14_06480"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0496"
FT   CDS_pept        568039..569016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06480"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15461"
FT                   /db_xref="GOA:A0A0H2ZKQ0"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ0"
FT                   /protein_id="ABJ15461.1"
FT                   /translation="MSIKVLKPGLATSVQDAGREGHYHLGIPPSGALDQYALRAANLLV
FT                   GNAPTAAVLECALLGPQLEFQRDALVAVCGARMTPRLEGAEMPLDTSFRVRAGQVLGFD
FT                   FIRAGARGYLAIDGGIAVPEVLGSRSTYGLGAIGGLQGRRLAEGDLLPLGPASPSAVEG
FT                   LALPRSLQVEVGGEVSLRVVPGLYVHRLTPDAVERFFAETWTVGSEADRTGYRFKGGTA
FT                   LRFEPREQPFGAGSDPSNIVDACYPIGSIQVPGGLEPIVLHRDAVSGGGYATLGTVISP
FT                   DLNRLAQMQPNQKARFVAVSLEEGLEARRRYNWQVQRLQHFFLR"
FT   gene            569617..570675
FT                   /gene="bioB"
FT                   /locus_tag="PA14_06500"
FT   CDS_pept        569617..570675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="PA14_06500"
FT                   /product="biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15462"
FT                   /db_xref="GOA:Q02TR6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TR6"
FT                   /protein_id="ABJ15462.1"
FT                   /translation="MSATASVATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAYFDPNR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTS
FT                   PEFYGNIITTRTYSERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVKGTPLAEEKDVDPFDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQAL
FT                   AFMAGANSIFYGEKLLTTKNPQAEKDMQLFARLGIKPEEREEHADEVHQAAIEQALVEQ
FT                   RESKLFYNAASA"
FT   gene            570781..571986
FT                   /gene="bioF"
FT                   /locus_tag="PA14_06510"
FT   CDS_pept        570781..571986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="PA14_06510"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15463"
FT                   /db_xref="GOA:Q02TR5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TR5"
FT                   /protein_id="ABJ15463.1"
FT                   /translation="MSFDLASRLASRRAEDLYRQRPLLESAQGPDVVVDGQPLLAFCSN
FT                   DYLGLANHPEVIAALRAGAERWGVGGGASHLVVGHSGPHHELELALAEFTGRPRALLFS
FT                   TGYMANLGAVTALVGKGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDPASLAARLDKA
FT                   EGNTLVVTDGVFSMDGNLADLPALAAVAQARGAWLMVDDAHGFGPLGASGGGIVEHFGL
FT                   GQEQVPVLIGTLGKGFGTAGAFVAGSEELIETLIQYARPYIYTTSQPPAVACATLKSLE
FT                   LLRRESWRRQHLAALIARFRHGAEALGLTLMDSFTPIQPILVGGSRQAVALAGMLRARG
FT                   IMVGAIRPPTVPANSARLRVTLSAAHSEAQVDRLLEALGESWRQLSSSLLAEIEAEEGD
FT                   DA"
FT   gene            571979..572701
FT                   /gene="bioH"
FT                   /locus_tag="PA14_06530"
FT   CDS_pept        571979..572701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="PA14_06530"
FT                   /product="putative biotin biosynthesis protein bioH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15464"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD0"
FT                   /protein_id="ABJ15464.1"
FT                   /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDA
FT                   ADWLDELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVREDWPNA
FT                   MPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVAGLQ
FT                   LLGQLDTRAALENFRGPQLHLFAEADALVPVAAAEALLEWLPDVEVSTLAASHGLPLEC
FT                   PDEVASAILRFLREGDDA"
FT   gene            572694..573518
FT                   /gene="bioC"
FT                   /locus_tag="PA14_06540"
FT   CDS_pept        572694..573518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="PA14_06540"
FT                   /product="putative biotin synthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15465"
FT                   /db_xref="GOA:A0A0H2ZLC0"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC0"
FT                   /protein_id="ABJ15465.1"
FT                   /translation="MPDDSAPLLAPHGVAALPDKRRVAASFSRAAASYDAVAELQRGVG
FT                   ESLLSALPEGFSPRRWVDLGCGTGHFSRALERRFGAAEGLAVDIAEGMLRHARARGGAS
FT                   HFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCVGTL
FT                   GELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLTLRHEDRVLHFPDLRSLTHELK
FT                   ALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPEGLPATYRVVFGVLRKDS"
FT   gene            573522..574208
FT                   /gene="bioD"
FT                   /locus_tag="PA14_06570"
FT   CDS_pept        573522..574208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="PA14_06570"
FT                   /product="dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15466"
FT                   /db_xref="GOA:Q02TR2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TR2"
FT                   /protein_id="ABJ15466.1"
FT                   /translation="MPAFFVTGTDTEIGKTTIAAGLLHAARRAGLSTAAAKPVASGCEP
FT                   TAQGLRNGDALALLGQCSLALAYEQVNPLAFAPAIAPHLAAREAGVELSAARLHEAVRE
FT                   VLALQADLTLVEGAGGWRVPLQGRENLSDLARLLALPVVLVVGVRLGCINHALLSAEAI
FT                   LGDGLALAGWVANVVDPATSRLEENLATLAERLPAPCLGRVPRLEEATPAAVAAHLDLR
FT                   PLGIGL"
FT   gene            574317..574547
FT                   /locus_tag="PA14_06580"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0505"
FT   CDS_pept        574317..574547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL39"
FT                   /protein_id="ABJ15467.1"
FT                   /translation="MEISGNAFVSGLNAVQSGSARVAQAGSEIARNTVEARSPQAEQMV
FT                   ELTRGKLEAQSGARVIEVADETLGTLIDTHA"
FT   gene            574888..576693
FT                   /locus_tag="PA14_06600"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0506"
FT   CDS_pept        574888..576693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06600"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15468"
FT                   /db_xref="GOA:A0A0H2ZLI5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLI5"
FT                   /protein_id="ABJ15468.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGAEDATPDMVNAILEE
FT                   GAKFCEQVIAPLNRVGDLEGCTWSADGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGGQG
FT                   LPESLGLAISEMVGQANWSWGMYPGLSHGAMNTLHAHGTAEQQATYLTKLVSGEWTGTM
FT                   CLTEPHCGTDLGMLRTKAEPQADGSYKVTGTKIFISAGEHDMADNIVHIVLARLPDAPQ
FT                   GTKGISLFIVPKFLPNAEGNAGERNAVSCGSIEHKMGIHGNATCVMNFDAATGFLIGPP
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVGFQGGIAYARERLQMRSLTGPKAPEKPADPI
FT                   IVHPDVRRMLLTMKAFAEGNRAMLYFAAKQVDIVQRSQDEEQKKAADSMLAFLTPIAKA
FT                   FMTEVGFESANHGVQIFGGHGFIAEHGMEQNVRDSRISMLYEGTTGVQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQANEANEAVKEFVAPLAQLNKEWGDLTMKVGMAAMKDREEVG
FT                   AASVDYLMYSGYACLAYFWADMARLAAEKLAAGTGEEAFYKAKLQTARFYFQRILPRTR
FT                   AHVAAMLSGANNLMEMAEEDFALGY"
FT   gene            576906..578702
FT                   /locus_tag="PA14_06620"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0507"
FT   CDS_pept        576906..578702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06620"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15469"
FT                   /db_xref="GOA:A0A0H2ZKQ6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ6"
FT                   /protein_id="ABJ15469.1"
FT                   /translation="MPEYKAPLRDMRFLIDEVFDFHGRYQALGASDATPDMVAAILDEG
FT                   SKFCEQVLAPLNRSGDEEGCHFDNGVVTTPKGFKEAYAQYVEGGWNGVASDPAYGGQGL
FT                   PHSLGLLLSEMIGSSNVSWGMYPGLTRGAMSAIHAHGSQAQKDLYLARMTAGTWTGTMC
FT                   LTEPHCGTDLGIIKTRAVPNADGSHAISGTKIFISAGEHDLSENIVHLVLAKLPDAPAG
FT                   TKGISLFIVPKFLPDAEGNVGARNAVSCGSIEHKMGIKASATCVMNFDGATGYLIGEPN
FT                   KGLHCMFTMMNHARLGTGMQGLCLGETSYQGAVRYARERLQMRSLTGPKAPDKPADPII
FT                   VHPDVRRMLLTMKAFNEGNRALAYFTAQLLDTEHLSQDAAERERAADLLAFLTPICKAF
FT                   MTETGQEVTNLGMQVYGGHGYIREWGMEQLVRDCRIAQIYEGTNGIQALDLLGRKVLGS
FT                   QGKLLRGFTKLVHQLCQAQAEHPQLKGQVAQLAALNAQWGELTQQVGLAAMKNADEVGA
FT                   ASVDYLMFSGYVTLAYFWLRIALVAREKLDAGSGEAAFYEAKLATADFYFSRLLPRTAA
FT                   HAAAIQAGAAGLMSLSAEQFSL"
FT   gene            578977..580755
FT                   /locus_tag="PA14_06640"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0508"
FT   CDS_pept        578977..580755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06640"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15470"
FT                   /db_xref="GOA:A0A0H2ZKD5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD5"
FT                   /protein_id="ABJ15470.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFEVSRLWAQLPALAEVVDAETAAAILE
FT                   EAGKVTAGTIAPLNRPGDEEGCQWNAGAVSTPAGFPEAYRTYAEGGWVGVGGDPAYGGM
FT                   GMPKVISAQVEELVNSANLSFGLYPMLTAGACLALNAHASDELKDKYLPNMYAGIWAGS
FT                   MCLTEPHAGTDLGIIRTKAEPQADGSYKISGTKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKVLVNADGSLGEKNSLGCGSIEHKMGIKASATCVMNFDGATGWLVGE
FT                   VNKGLAAMFTMMNYERLGVGIQGLATGERSYQSAIEYARERIQSRAPTGPVAKDKAADP
FT                   IIVHPDVRRMLLTMKALNEGGRAFSSYVAMQLDTAKYSEDAVTRKRAEELVALLTPVAK
FT                   AFLTDMGLETTIHGQQIFGGHGFIREWGQEQLVRDCRITQIYEGTNGIQALDLVGRKVI
FT                   GSGGAFSRHFTDEIKAFVASADEALGEFSKPLAAAVENLEELTAWLLDRAKGNPNEIGA
FT                   ASVEYLHVFGYTAYAYMWALMARTALAKQGEDDFYASKLGTARFYFARLLPRIHSLSAS
FT                   VRAGSESLYLLDAEQF"
FT   gene            complement(581088..582569)
FT                   /gene="nirN"
FT                   /locus_tag="PA14_06650"
FT   CDS_pept        complement(581088..582569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirN"
FT                   /locus_tag="PA14_06650"
FT                   /product="putative c-type cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15471"
FT                   /db_xref="GOA:A0A0H2ZLC5"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC5"
FT                   /protein_id="ABJ15471.1"
FT                   /translation="MRLIGLALGLLLGALAQAGEAPGEALYRQHCQACHGAGRLGGSGP
FT                   TLLPESLSRLKPAQAREVILHGRPATQMAGFAGQLDDAAADALVAYLYQAPPREPQWSA
FT                   ENIRASQVQPHPLATLPSRPRFEADPLNLFVVVESGDHHVTILDGDRFEPIARFPSRYA
FT                   LHGGPKFSPDGRLVYFASRDGWVTLYDLYNLKVVAEVRAGLNTRNLAVSDDGRWVLVGN
FT                   YLPGNLVLLDARDLSLVQVIPAADAQGQASRVSAVYTAPPRHSFVVALKDVHELWELPY
FT                   ANGKPVAPKRLAVADYLDDFSFSPDYRYLLGSSRQARGGEVIELDSGARVASIPLSGMP
FT                   HLGSGIYWKRDGRWVFATPNISRGVISVIDLQNWKPLKEIVTDGPGFFMRSHADSPYAW
FT                   TDTFLGKKHDEILLIDKQTLEIAHRLRPSPGKVAGHVEFTRDGRYALLSVWDRDGALVV
FT                   YDAHSLEEVKRLPMNKPSGKYNVGNKIGYAEGTSH"
FT   gene            complement(582560..583399)
FT                   /gene="nirE"
FT                   /locus_tag="PA14_06660"
FT   CDS_pept        complement(582560..583399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirE"
FT                   /locus_tag="PA14_06660"
FT                   /product="putative uroporphyrin-III c-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15472"
FT                   /db_xref="GOA:A0A0H2ZL42"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL42"
FT                   /protein_id="ABJ15472.1"
FT                   /translation="MNTTVIPPSLLDVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAE
FT                   VVVYDRLVARELIALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLKGG
FT                   DPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQ
FT                   NDGRLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQV
FT                   TRGALSELPALARRYQLKPPTLIVVGQVVALFAERAMAHPSYLGAGSPVSREAVACA"
FT   gene            complement(583410..584573)
FT                   /gene="nirJ"
FT                   /locus_tag="PA14_06670"
FT   CDS_pept        complement(583410..584573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="PA14_06670"
FT                   /product="heme d1 biosynthesis protein NirJ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15473"
FT                   /db_xref="GOA:A0A0H2ZLJ1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ1"
FT                   /protein_id="ABJ15473.1"
FT                   /translation="MLRISHYLRSLAEDAPAPRRAGGRRAPVVIWNLLRRCNLTCKHCY
FT                   STSADSDFRGELETAEILRGIDDLRAAGVRVLILSGGEPLMHPDLFEIAAHARQAGMFV
FT                   ALSSNGTLIDEGNIQRVAEARFDYVGISLDGLRETHDRFRQKQGSFDAALAAMRLCREA
FT                   DIRVGMRTTLTEENAAQLPALLDLMRELDVQKFYLSHLNYSGRGRRSRALDAHHRRTRE
FT                   ALALLFERADEDIRQGRDSDFVTGNNDADAILLLDWLKRRRPQQLARLCELLLDWGGNA
FT                   SGEGIANIDNTGEVHPDSYWWHHSVGNIRHQRFADFWFERPDPLLLQLRQRPRPVVGRC
FT                   SQCRWLDICNGNTRTRAWAGGELWGEDPGCYLSDQEIGLERIALHAV"
FT   gene            complement(584567..585082)
FT                   /gene="nirH"
FT                   /locus_tag="PA14_06680"
FT   CDS_pept        complement(584567..585082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirH"
FT                   /locus_tag="PA14_06680"
FT                   /product="heme d1 biosynthesis protein NirH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15474"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR1"
FT                   /protein_id="ABJ15474.1"
FT                   /translation="MSACISPSDALLARRLIELTQAGLPLVADPWAWIAAQLRLSEAET
FT                   LALLKRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSHCY
FT                   RRPRHLPQWRYNLFAMVHGRSEAEIEGYRQQIRLLLGEDCRADEMLVSSRILKKTGLRL
FT                   AQKEERPC"
FT   gene            complement(585057..585500)
FT                   /gene="nirG"
FT                   /locus_tag="PA14_06690"
FT   CDS_pept        complement(585057..585500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirG"
FT                   /locus_tag="PA14_06690"
FT                   /product="heme d1 biosynthesis protein NirG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15475"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE0"
FT                   /protein_id="ABJ15475.1"
FT                   /translation="MDEFDRRLLNRLQHGLPLEPHPYALLAAELDCREEDILRRLDDLL
FT                   DDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEEIAALLAGWPQVAHNYRREHALNMW
FT                   LVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
FT   gene            complement(585493..586017)
FT                   /gene="nirL"
FT                   /locus_tag="PA14_06700"
FT   CDS_pept        complement(585493..586017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirL"
FT                   /locus_tag="PA14_06700"
FT                   /product="heme d1 biosynthesis protein NirL"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15476"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD1"
FT                   /protein_id="ABJ15476.1"
FT                   /translation="MNPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEVL
FT                   EQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDVVGRALAHETIVSLCYR
FT                   RPRRLPMWPYNLFCMIHGRERGEVERQIEALLERHALRQTPHRWLFSLRAYKQCGGRYT
FT                   APPADLERRHG"
FT   gene            complement(586014..586466)
FT                   /gene="nirD"
FT                   /locus_tag="PA14_06710"
FT   CDS_pept        complement(586014..586466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="PA14_06710"
FT                   /product="heme d1 biosynthesis protein NirD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15477"
FT                   /db_xref="GOA:A0A0H2ZL47"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL47"
FT                   /protein_id="ABJ15477.1"
FT                   /translation="MDDLSRRLLARYQKGLPICAEPYRRMAETLGCSEAEVLERLRRLE
FT                   ADGALSRVGPVLRHQRAGASTLAALAVPEERLQRVAERISQYAEVNHNYQREHRYNLWF
FT                   VLTAGDRAQLDRVLAEIAADTGLQPLDLPMQEAYCIDLAFPLEASR"
FT   gene            complement(586475..587653)
FT                   /gene="nirF"
FT                   /locus_tag="PA14_06720"
FT   CDS_pept        complement(586475..587653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="PA14_06720"
FT                   /product="heme d1 biosynthesis protein NirF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15478"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ6"
FT                   /protein_id="ABJ15478.1"
FT                   /translation="MNLRPLAPLFLALLAGCSQQPPLRGSGDLGVLIERADGSVQILDG
FT                   TAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTKLDLLAQRIDKRLIQGGNSI
FT                   GGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAPGQR
FT                   FVFSLFDSGEIWIADFSQGDTPHLTRFRDIGKQPYDALISPDGRYYMAGLFGEDGMAQL
FT                   DLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVLDARDW
FT                   KQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPGPGVLHM
FT                   EFSGRGDQVWISVRDADQLQVWDPYRLKRIGSLPARSPSGIFFSHRAQHIGL"
FT   gene            complement(587650..588009)
FT                   /gene="nirC"
FT                   /locus_tag="PA14_06730"
FT   CDS_pept        complement(587650..588009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="PA14_06730"
FT                   /product="putative c-type cytochrome precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15479"
FT                   /db_xref="GOA:A0A0H2ZKR4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR4"
FT                   /protein_id="ABJ15479.1"
FT                   /translation="MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRH
FT                   LLLQDCGSCHGLRLTGGLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSEDD
FT                   AGWLVDRLIEGEIAP"
FT   gene            complement(588006..588320)
FT                   /gene="nirM"
FT                   /locus_tag="PA14_06740"
FT   CDS_pept        complement(588006..588320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirM"
FT                   /locus_tag="PA14_06740"
FT                   /product="cytochrome c-551 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15480"
FT                   /db_xref="GOA:A0A0H2ZKE3"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE3"
FT                   /protein_id="ABJ15480.1"
FT                   /translation="MKPYALLSLLATGTLLAQGAWAEDPEVLFKNKGCVACHAIDTKMV
FT                   GPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
FT                   "
FT   gene            complement(588371..590077)
FT                   /gene="nirS"
FT                   /locus_tag="PA14_06750"
FT   CDS_pept        complement(588371..590077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirS"
FT                   /locus_tag="PA14_06750"
FT                   /product="nitrite reductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15481"
FT                   /db_xref="GOA:A0A0H2ZLD6"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD6"
FT                   /protein_id="ABJ15481.1"
FT                   /translation="MPFGKPLVGTLLASLTLLGLATAHAKDDMKAAEQYQGAASAVDPT
FT                   HVVRTNGAPDMSESEFNEAKQIYFQRCAGCHGVLRKGATGKPLTPDITQQRGQQYLEAL
FT                   ITYGTPLGMPNWGSSGELSKDQITLMAKYIQHTPPQPPEWGMPEMRESWKVLVKPEDRP
FT                   KKQLNDLDLPNLFSVTLRDAGQIALVDGDSKKIVKVIDTGYAVHISRMSASGRYLLVIG
FT                   RDARIDMIDLWAKEPTKVAEIKIGIEARSVESSKFKGYEDRYTIAGAYWPPQFAIMDGE
FT                   TLEPKQIVSTRGMTVDTQTYHPEPRVAAIIASHEHPEFIVNVKETGKVLLVNYKDIDNL
FT                   TVTSIGAAPFLHDGGWDSSHRYFMTAANNSNKVAVIDSKDRRLSALVDVGKTPHPGRGA
FT                   NFVHPKYGPVWSTSHLGDGSISLIGTDPKNHPQYAWKKVAELQGQGGGSLFIKTHPKSS
FT                   HLYVDTTFNPDARISQSVAVFDLKNLDAKYQVLPIAEWADLGEGAKRVVQPEYNKRGDE
FT                   VWFSVWNGKNDSSALVVVDDKTLKLKAVVKDPRLITPTGKFNVYNTQHDVY"
FT   gene            590293..591075
FT                   /gene="nirQ"
FT                   /locus_tag="PA14_06770"
FT   CDS_pept        590293..591075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirQ"
FT                   /locus_tag="PA14_06770"
FT                   /product="regulatory protein NirQ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15482"
FT                   /db_xref="GOA:A0A0H2ZL51"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL51"
FT                   /protein_id="ABJ15482.1"
FT                   /translation="MRDATPFYEATGHEIEVFERAWRHGLPVLLKGPTGCGKTRFVQYM
FT                   ARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVEAR
FT                   QDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQRFVA
FT                   LRFDYPAAQHEARILVGESGCAEALAQRLVQLGQALRRLEQHDLEEVASTRLLIFAARL
FT                   IGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVA"
FT   gene            591110..591637
FT                   /gene="nirO"
FT                   /locus_tag="PA14_06790"
FT   CDS_pept        591110..591637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirO"
FT                   /locus_tag="PA14_06790"
FT                   /product="cytochrome c oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15483"
FT                   /db_xref="GOA:A0A0H2ZLK1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLK1"
FT                   /protein_id="ABJ15483.1"
FT                   /translation="MWFFILAELSVFSLLLLAFAGAQAWQPELFRAGREQLDSRWGLLL
FT                   TVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVYVGLKLHEYGRLADLGLDIE
FT                   HDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRCYTPQACSGLESGVLYWHMVDLV
FT                   WVLLFPLVYVLQ"
FT   gene            591645..591902
FT                   /locus_tag="PA14_06800"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0522"
FT   CDS_pept        591645..591902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15484"
FT                   /db_xref="GOA:A0A0H2ZKR8"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR8"
FT                   /protein_id="ABJ15484.1"
FT                   /translation="MRTLTLCWLALLALAVAGVLLGGAGDSPWLLAAVLACAVAKGWLI
FT                   GERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
FT   gene            591992..592432
FT                   /gene="norC"
FT                   /locus_tag="PA14_06810"
FT   CDS_pept        591992..592432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="PA14_06810"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15485"
FT                   /db_xref="GOA:A0A0H2ZKE8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE8"
FT                   /protein_id="ABJ15485.1"
FT                   /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAM
FT                   SAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
FT                   NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
FT   gene            592432..593829
FT                   /gene="norB"
FT                   /locus_tag="PA14_06830"
FT   CDS_pept        592432..593829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PA14_06830"
FT                   /product="nitric-oxide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15486"
FT                   /db_xref="GOA:A0A0H2ZLE2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE2"
FT                   /protein_id="ABJ15486.1"
FT                   /translation="MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGD
FT                   FLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAA
FT                   GVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVL
FT                   RGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAIL
FT                   AFVLVKVTGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEP
FT                   LPFFAMVLFAFNTINRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHG
FT                   TQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVF
FT                   ITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSF
FT                   RRGKAAA"
FT   gene            593831..595669
FT                   /gene="norD"
FT                   /locus_tag="PA14_06840"
FT   CDS_pept        593831..595669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norD"
FT                   /locus_tag="PA14_06840"
FT                   /product="putative dinitrification protein NorD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15487"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL56"
FT                   /protein_id="ABJ15487.1"
FT                   /translation="MAFAVELEEWVGAHWHRFITRHASGEFEAARVTLESMRRPLGMLF
FT                   RALGGAPGVALEATPARRLLLRRTWLQRVAGTCEQAPVSWFNGDSLRLPESLAVYPQAE
FT                   LNRELYRWLALLAASAGPLRHWAQDNQRWARQLLDAYPALRPRYARLVAAHLRQRPSLD
FT                   DCPAADAELEIALRRALAEPGSVERFPRVERAPWPVPLWLYPGERWTPSASAEDGEEAA
FT                   AGAGKRQVARSGARKRAERVEERESERNLLLFRLESLLSWSEHLALDRCSDDEDDPDGA
FT                   RVAEDLDYLSLSRQRTQKGGGLRLDLDLPAADYDDLPLGPGLKLPEWDYRQQRLLSDHV
FT                   LLQPMRPRGATSASLPAHLEKTALHLRRQFACLRDGRQRLRQQPQGDEIDLDAWLDFQV
FT                   ERRRGGSTQPGLFLEQRPRRRDLACLLLADLSMSTEAYLDDQRRVIDSIVDSLLLFGEA
FT                   LQALGDPFALYGFSSVRRQQVRWQVLKDFDEGYGGEVRGRVLALSPGYYTRMGAAIRRA
FT                   SQELGGQPQKRRLLLLLSDGKPNDLDRYEGRYGIEDTRQAVIEARSQGLVPFCITIDKE
FT                   AADYLPYLFGADGFALVERAGQLPERLLQLYRRLRR"
FT   gene            complement(595676..595870)
FT                   /locus_tag="PA14_06860"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0526"
FT   CDS_pept        complement(595676..595870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15488"
FT                   /db_xref="GOA:A0A0H2ZLK8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLK8"
FT                   /protein_id="ABJ15488.1"
FT                   /translation="MRQCLYCLHETEGAESACEQCGMPLPSASQRQLQGRRQRRFAWFC
FT                   VGLALFCLGMMLWLPRDVP"
FT   gene            complement(595954..596637)
FT                   /gene="dnr"
FT                   /locus_tag="PA14_06870"
FT   CDS_pept        complement(595954..596637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnr"
FT                   /locus_tag="PA14_06870"
FT                   /product="transcriptional regulator Dnr"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15489"
FT                   /db_xref="GOA:A0A0H2ZKS2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS2"
FT                   /protein_id="ABJ15489.1"
FT                   /translation="MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFR
FT                   QGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVV
FT                   PSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLT
FT                   LAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIRLDGREISILDRER
FT                   LECFE"
FT   gene            596840..596963
FT                   /locus_tag="PA14_06875"
FT   rRNA            596840..596963
FT                   /locus_tag="PA14_06875"
FT                   /product="rsmYregulatoryRNA"
FT   gene            complement(596990..597868)
FT                   /locus_tag="PA14_06880"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0528"
FT   CDS_pept        complement(596990..597868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06880"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06880"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15490"
FT                   /db_xref="GOA:A0A0H2ZKF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF4"
FT                   /protein_id="ABJ15490.1"
FT                   /translation="MDFRQLRYFVALYEEGHVGRAAERLALSQPALSQQIRQLEQNLDV
FT                   SLFQRSGKRLLPTVAAHTLYNHAVPLLEGLERAREAMRVFRGQTPRSLAIGVLQTVNAS
FT                   LVPYMVERLHAAQPHLRVQIYELSGIDIERRLLTGNLDIGIGFLPPRQPGLHSVELYED
FT                   ELQLVIPEEHPLKEFRKVSLAQAAELPMLLLGEEFRARQIWQEQLAAIGRRPRVQAELN
FT                   HMSGILDSLPQTRFATVLPGKARQMHSNQRLLWKPLSEPRIPLKVGLVYRDAQRQHASV
FT                   ELLRSLLEGVV"
FT   gene            597970..598671
FT                   /locus_tag="PA14_06890"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0529"
FT   CDS_pept        597970..598671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06890"
FT                   /product="putative sulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15491"
FT                   /db_xref="GOA:A0A0H2ZLE8"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE8"
FT                   /protein_id="ABJ15491.1"
FT                   /translation="MEQIVVNGVFIGKVEETWGGLVSAIDKLPVEQEFWLGHDGLPGDE
FT                   QADIRHHGGLERALHHYPAEHYRYWRKRHPLNRWQLPAFGENISTYGITEAEVCIGDQF
FT                   HWGDALLEVSQPRSPCYRQGQRWNLPELPDELQSGGRCGWFYRVLRSGMVTPGDELKLV
FT                   QRHYPELTVARLLQWYFGDPLEPLGLRQMMACDALSQRWRKTAAKRLSSGVVEDWGPRL
FT                   RGPSDYREHAS"
FT   gene            598668..598904
FT                   /locus_tag="PA14_06900"
FT   CDS_pept        598668..598904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL60"
FT                   /protein_id="ABJ15492.1"
FT                   /translation="MSDYLITLSQSGRLLASMTVSAARFAEVRELMRQRFPAGDGFELR
FT                   IETRRESRRLLEQGPQGVRLLAVEYMTEELKDG"
FT   gene            598897..600078
FT                   /gene="argD"
FT                   /locus_tag="PA14_06920"
FT   CDS_pept        598897..600078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="PA14_06920"
FT                   /product="class III pyridoxal phosphate-dependent
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15493"
FT                   /db_xref="GOA:A0A0H2ZLL5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLL5"
FT                   /protein_id="ABJ15493.1"
FT                   /translation="MADALDSLRLMRTQERPAQVFVRGQGSWLWDSDGRAFLDFTQGLA
FT                   VNCLGHSPSVLVQALARQARELVSAGPGLLNRPVLALAQRLCLATGSDQAYFLTSGAEA
FT                   NEAAIALARKWGRLHRGGAQRIVSTVNSIHGRTPGTLTACGKPAQHGLEGFARVPFNDL
FT                   DAMAAAIDEETVAVMLEPVQGDAGVIPATLDYLRGIERLCRQRGVLLILDEVQTGIGRC
FT                   GALLAEELYGVRADIVTLGKGLGAGVPLSALLARGNACCFEPGDQLGTHHGNALMTAAG
FT                   LAVLNTVLEPGFLEQVREQGTHLRDGLARVARRYGHGPLRGQGLFWGLPLIGQRAPAVV
FT                   RAAFGEGLLINAPQPHCLRFSPALTVSRANVDEMLRRLERALARVANRHEEVA"
FT   gene            600078..600794
FT                   /locus_tag="PA14_06930"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0531"
FT   CDS_pept        600078..600794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06930"
FT                   /product="putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15494"
FT                   /db_xref="GOA:A0A0H2ZKS6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS6"
FT                   /protein_id="ABJ15494.1"
FT                   /translation="MRALVLQHVPFEGSARIGDWIGRHCEHEHVCYLYADAHLPALDSF
FT                   DLLVVMGGPMSVHDEAQYPWLVAEKRLIRAALDAGKKVLGICLGAQLLAQALGAAVRPG
FT                   RQAEIGWWPLHRYSQALGSPLGERLPERLMAFHWHGETFDLPAGSVPLYGSAACANQGF
FT                   IWNEQAIGLQCHLESTAESIEALLDACPQDLQREGAVQSAGRIRQGVAHCREVAPVLFL
FT                   LLDYLAHRPAEIARRA"
FT   gene            complement(600869..601375)
FT                   /locus_tag="PA14_06940"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0532"
FT   CDS_pept        complement(600869..601375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF9"
FT                   /protein_id="ABJ15495.1"
FT                   /translation="MPARPDRARVTIALAVLVHLHRETIAEAPLPWRYRKQCPGGKPRR
FT                   RAGREATPPLGPEVVDASTRLALHEKKAPSPCMSDAMSKNKHPDLGEIQRSLNQALEGY
FT                   DCQCRMHYDGTVSINVAAREHDETFTFVGIQPGELDNPTRLHLFAESLRRDLALLEPWL
FT                   GKHAA"
FT   gene            601418..602908
FT                   /locus_tag="PA14_06950"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0533"
FT   CDS_pept        601418..602908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06950"
FT                   /product="putative transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15496"
FT                   /db_xref="GOA:A0A0H2ZLF2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF2"
FT                   /protein_id="ABJ15496.1"
FT                   /translation="MNDQVLRTQTDRRQLQQIIAGLTEGVILIEPDQRILWANEAALAM
FT                   HGVDSLEGLGADTGEYRERFRLRYRNNHPLQEGQYPAERLVAGECFSDVVVEVFPAADE
FT                   DTRWVHRVRGLVLTTPEDKPDCLVLILHDATEWASAEQRFEKTFNANPAPAVICRLSDY
FT                   RYVKVNVGFLEMTGYARDQVIGRSVYELDVLDQAERRELAVERLGAGETIPQMEASLRV
FT                   AEGGRKCVVVAGQPIEVGEEACMLFTFTDLEPRKKAEEALRKSEERFAKAFRMAPVPSL
FT                   VLCGDDLQVLDINQAFSETFGYQAEELLGESTVACGLWQDGGAERLGELLAQSGSVRNV
FT                   QLRLQHKDRNGLDCLVSAEAVSLNEQDCVLVALLDISDRRRTEMELVHAIETVMQDASW
FT                   FSRTLIEKLANVRRANAPGTGAELADLTAREREVFDLICQGLADKEIAKELGLAPNTVR
FT                   NHVATIYAKLDVHSRGEAIVWARERGFAPEPRNGNGRK"
FT   gene            603247..604536
FT                   /locus_tag="PA14_06960"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0534"
FT   CDS_pept        603247..604536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06960"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15497"
FT                   /db_xref="GOA:A0A0H2ZL65"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL65"
FT                   /protein_id="ABJ15497.1"
FT                   /translation="MFLQSNEHVGTYYAAVNPELIQPRQALEGDLDCEVLVVGAGFSGL
FT                   HTALRLVEGGRQVCVIEASRIAWAASGRNGGQALPGWSSDLPPLEADLGYEGARRLWDG
FT                   MLWAAGEMRALPQRHGFDCDYRVGHLWTAILPRRVGLLYDWQAEANRRWGYEGLRFVAK
FT                   DELPEWIASERYLAGLYDPHAAHLNPLKLAFGLAAAIERAGGRIHERTRALSYREEGDG
FT                   YRVRTEHGEIRCAALVLACNAYIDGLDSELSQRMLPVGTYQVATEPLGEERAKSLLPRN
FT                   CCVTDNQFVLDYFRLTPDHRLLFGGGCTYLGGMPSDIRAATRPYLERVFPQLRGVALEY
FT                   AWGGHIDCSMRRTPDIGRQGNRYWLQGYSGHGVLPSLAAARAVSDALLGDDETLALYQR
FT                   LRNPKFPGGQRFAAPLEALGKAYYRLRDLF"
FT   gene            604554..605108
FT                   /locus_tag="PA14_06970"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0535"
FT   CDS_pept        604554..605108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06970"
FT                   /product="putative transcriptional regulator, Cro/CI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15498"
FT                   /db_xref="GOA:A0A0H2ZLM3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLM3"
FT                   /protein_id="ABJ15498.1"
FT                   /translation="MSEVADDLAEIASLVRELRKRKGITLQALADGIRRSVGFVSQVER
FT                   GLSRPAVDDLVAISQVLGVPATYFFCSPKTQASPWVTRPGERRTLAYARGASDNLVSPR
FT                   LGGAFFMLETCLEAGADSGERDLLDSSEQGGYVLEGELTLWLEDEELRLQAGDGFQIPS
FT                   HMRSRYANRSQAPVRVLWVYA"
FT   gene            complement(605219..606244)
FT                   /locus_tag="PA14_06980"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0536"
FT   CDS_pept        complement(605219..606244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06980"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15499"
FT                   /db_xref="GOA:A0A0H2ZKT0"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT0"
FT                   /protein_id="ABJ15499.1"
FT                   /translation="MRRLLLGAGLLLASLVAWADVPPIPALTARVTDLTATLSGDQRQH
FT                   LEQQLAALEAKSGAQLAVLLVPTTGDDSIEEYAVRTFEKWKLGQKKVDDGVLLLVAKND
FT                   RTLRIEVGYGLEGAITDVQAGRIISEQITPQFRQGNFYGGIQAGVDSLVQLIDAEKSPD
FT                   SATASAPVDALPAVPEATPPRALPAPVDEGEVYDSAPPEPKKKSGLSGQLWGNPVYLGV
FT                   YVAVLLAVALLGRLLPLQWMRRRSIGRFLLCSAAVAGLAWLLSMGLWQNVDRAADDSLG
FT                   VLAPTLFIYALFLLPGEVLMAILSAILNSRGGGGGGGSGGGGIFRGGGGSSGGGGASGR
FT                   W"
FT   gene            complement(606248..606856)
FT                   /locus_tag="PA14_06990"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0537"
FT   CDS_pept        complement(606248..606856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06990"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15500"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG2"
FT                   /protein_id="ABJ15500.1"
FT                   /translation="MPRFLRNALLPVLALLLSGCGYNAMQAGDEQVKAAWSEVLNQYQR
FT                   RADLVPNLVSTVKGYASHEASVLTQVTEARAKVGSVQLNADQLDDEQAVQRFQKAQGEL
FT                   SSALSRLLVVTENYPQLKADGLFKDLLTQLEGTENRIAVARGRYVKSVQEYNVLLRQFP
FT                   GVITAKLFGYKPKANFSVENEAAISTAPKVDFGNPQPAQ"
FT   gene            complement(606944..607453)
FT                   /gene="dsbB"
FT                   /locus_tag="PA14_07000"
FT   CDS_pept        complement(606944..607453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="PA14_07000"
FT                   /product="disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15501"
FT                   /db_xref="GOA:Q02TM7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TM7"
FT                   /protein_id="ABJ15501.1"
FT                   /translation="MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIF
FT                   IRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGS
FT                   CKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLA
FT                   FGRRTA"
FT   gene            607682..608512
FT                   /locus_tag="PA14_07010"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0539"
FT   CDS_pept        607682..608512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07010"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15502"
FT                   /db_xref="GOA:A0A0H2ZLF7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF7"
FT                   /protein_id="ABJ15502.1"
FT                   /translation="MLATSLVLCAAVLHATWNTLVKFSSDRLLVVACMDVVGVLCAILL
FT                   LPFVSLPPAEVWPWLLGATVLQLLYRVLLIEAYKVGDLGLVYPLMRGLSPLVVLGLTLA
FT                   FGGEQLSGRQILGILLIPFGMLCLLWGGGGSRLPWRTLPVVLLIGLCIGGYTWSDGNAL
FT                   KRWPLALDYLVWLTLLSGLPFPLIAAGARTRAFARFWALEWKLGLAVGVCVLASYGLVL
FT                   WAMQLGSIAEAAALRETSVLLAVLFGMRFLNEPFGLPRLLACGLVLAGMLLMKL"
FT   gene            608582..608968
FT                   /locus_tag="PA14_07020"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0540"
FT   CDS_pept        608582..608968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07020"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15503"
FT                   /db_xref="GOA:A0A0H2ZL70"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL70"
FT                   /protein_id="ABJ15503.1"
FT                   /translation="MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGGRANADPRAFLGSLE
FT                   GFRRRANNAQLNAFEVTPAFAAAVIIAHLVGNASQATLDSLAIAWITSRLLYVICYLAD
FT                   WGPLRSLVWFVGMLLIAAFFVVSA"
FT   gene            609082..609540
FT                   /locus_tag="PA14_07030"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0541"
FT   CDS_pept        609082..609540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07030"
FT                   /product="putative cytochrome c'"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15504"
FT                   /db_xref="GOA:A0A0H2ZLN0"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLN0"
FT                   /protein_id="ABJ15504.1"
FT                   /translation="MKLKSLLVVLLAGVALSGCHRMDPNSPEAKRQAIFKEMLRTSEDM
FT                   GGMLRGRLPFDAEKFRAGSAKLHQLADQPWQYFPSPKAGEEGEDTRAKDEVWQRQQEFK
FT                   AATQVFIDAMNRLQDNTRQATPTPDGVRKDFAAVEDACEACHKKFRAL"
FT   gene            complement(609732..610151)
FT                   /gene="yqjC"
FT                   /locus_tag="PA14_07040"
FT   CDS_pept        complement(609732..610151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjC"
FT                   /locus_tag="PA14_07040"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15505"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT4"
FT                   /protein_id="ABJ15505.1"
FT                   /translation="MSIRPSLPLAGLLLAVSLPLSAAQPGTTKGAPLSGCAAKQAAIEA
FT                   KLETARSFANEGQVAGLEKALSEVKEHCTEAGLLRENKQKVIDSEREVSEREKDLRKAM
FT                   GKGDPEKIEKRKAKLAEARAELEEAKKGLEQAQAQ"
FT   gene            610401..611369
FT                   /locus_tag="PA14_07050"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0543"
FT   CDS_pept        610401..611369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07050"
FT                   /product="putative depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15506"
FT                   /db_xref="GOA:A0A0H2ZKG7"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG7"
FT                   /protein_id="ABJ15506.1"
FT                   /translation="MRTLIRLVRTLILLLVLALLAGAWWWLQDEALRTPALAGHSEDSS
FT                   LKVAGLRRHYLLYVPPGVTEGAPLLVVLHGSRGDGAQMRRISGYGFDRLAAQEGFLVAY
FT                   PDGFEGHWNDCRKAASYSARLRDVDDVAFLRALVARLAQEYRVDPQRVYVAGYSNGGQM
FT                   AFRLAAEAPGLPAAIATVAASLPTTENDACRPVERPTAALLINGTRDPINPYLGGKVSL
FT                   FGFGDRGAVRSTLDSARWWAGLNGIAAPPAVAPLTRPGPVWTERQRWQEDGHPPVELLS
FT                   VHGGGHVLAQPDYRFPRILGKSDPELDAPAEIWRFFSQLPR"
FT   gene            complement(611373..612116)
FT                   /locus_tag="PA14_07060"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0544"
FT   CDS_pept        complement(611373..612116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15507"
FT                   /db_xref="GOA:A0A0H2ZLG2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLG2"
FT                   /protein_id="ABJ15507.1"
FT                   /translation="MKIRLLSDLHHEHFDGRRQLPEVEADVVVLAGDIHSHLEGLHWAR
FT                   ETFADSEIVYVAGNHEFYSSEMTDLTQAMRNIARALDIHFLENDEARIGPARFLGATLW
FT                   TDFQLYGADGYAPAHELALQSMPDFSCIDWFGGDFTPEQSIALHRASRDWLAEQLARPH
FT                   DGPTLVVSHHAPSALSIPPQFVGNPLSPAFASNLDELLAQADYWLHGHVHDALDYRIGR
FT                   ARVLANPGGYPHERGGFRPEFVFEV"
FT   gene            612321..613625
FT                   /locus_tag="PA14_07070"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0545"
FT   CDS_pept        612321..613625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07070"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15508"
FT                   /db_xref="GOA:A0A0H2ZL75"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL75"
FT                   /protein_id="ABJ15508.1"
FT                   /translation="MKLLWGVLAAALAAWGLTLAVDPPASLDIWVVRKQAILLTGVASF
FT                   ALMSLIMLLAVRPVWLEKPLDGLDRMYRLHKWAGILAIVLGLLHYLLELAGPWLAGIVG
FT                   KPVKGPRVETFLDVFRGSAKELGEWSAWILGGMLLITLWQRFPYHLWRYVHKALALVYL
FT                   VLAFHSVVLAPASYWSQPAGWLVAACALLGSACALLSLSGRIGRARRHAGVVTAVERRG
FT                   ESLLEVTCRLQGDWSHRAGQFAFLTCDRLEGAHPFTIASADRGCGEVRFSIKVLGDYTR
FT                   RLQDNLEVGARVEVEGPYGCFDFRRGLAGRQVWVAAGIGVTPFIAWLESLQAVPESAPS
FT                   VELHYCVRNSQEALFAGRLRELCEHLPSVTLHIRYSDEQGKPQAAQLGVLKSAEGRWPS
FT                   VWFCGPQGLADSLRRDLRRQGMPLRLFHQEAFRMR"
FT   gene            complement(613682..614872)
FT                   /gene="metK"
FT                   /locus_tag="PA14_07090"
FT   CDS_pept        complement(613682..614872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="PA14_07090"
FT                   /product="methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15509"
FT                   /db_xref="GOA:Q02TL9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TL9"
FT                   /protein_id="ABJ15509.1"
FT                   /translation="MSEYSVFTSESVSEGHPDKIADQISDAVLDAIIAKDKYARVACET
FT                   LVKTGVAIIAGEVTTSAWVDLEELVRKVIIDIGYDSSDVGFDGATCGVLNIIGKQSVDI
FT                   NQGVDRAKPEDQGAGDQGLMFGYASNETDVLMPAPICFSHRLVERQAEARKSGLLPWLR
FT                   PDAKSQVTCRYEGGKVVGIDAVVLSTQHNPEVSYNDLRDGVMELIIKQVLPAELLHKDT
FT                   QFHINPTGNFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKVSDEKIVQLVREHFDLRPY
FT                   AITKMLDLLHPMYQPTAAYGHFGRHPFELTVDGDTFTAFTWEKTDKAALLRDAAGL"
FT   gene            complement(614888..615889)
FT                   /locus_tag="PA14_07110"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0547"
FT   CDS_pept        complement(614888..615889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07110"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15510"
FT                   /db_xref="GOA:A0A0H2ZLN6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLN6"
FT                   /protein_id="ABJ15510.1"
FT                   /translation="MSLRVPSIRPDDYDPLAALCKAAGDSLRLNVLRALANDSFGVLEL
FT                   AQIFAIGQSGMSHHLKVLAQAGLVATRREGNAIFYRRSLPLAERTGGALHAALLEEVDE
FT                   RALPDDVRARIDAVHAQRAAVSQDFFARAADKFQAQQDLIAGLPQYRESVLALLDALAF
FT                   APGATALEVGPGDGGFLPELARRFRQVTALDNSAAMLELARQRCKEEGLGNVRLELADA
FT                   LQDAAEPADCVVLNMVLHHFAAPAEALKQLARLVHPGGSLLVTDLCRHNQGWAREACGD
FT                   LWLGFEQEDLAQWADAAGLTPGESLYIGLRNGFQIQVRHFARDASESRLTHR"
FT   gene            616135..618132
FT                   /gene="tktA"
FT                   /locus_tag="PA14_07130"
FT   CDS_pept        616135..618132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="PA14_07130"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15511"
FT                   /db_xref="GOA:A0A0H2ZKT8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT8"
FT                   /protein_id="ABJ15511.1"
FT                   /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYM
FT                   QHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYG
FT                   YTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGIS
FT                   HEVASLAGTLRLNKLIAFYDDNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDGHDAD
FT                   EIKTAIDTARKSDQPTLICCKTVIGFGSPNKQGKEECHGAPLGADEIAATRAALGWEHA
FT                   PFEIPAQIYAEWDAKETGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKA
FT                   AAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSADD
FT                   AAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYV
FT                   FTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALI
FT                   FSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGR
FT                   KVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSF
FT                   GESAPAPALFEHFGFTLDNVLAVAEELLED"
FT   gene            618132..619196
FT                   /locus_tag="PA14_07140"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0549"
FT   CDS_pept        618132..619196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG9"
FT                   /protein_id="ABJ15512.1"
FT                   /translation="MHTLYWRDLESPANGEWLGLAVQVEGAHRAPSFLHLQSGGQARIR
FT                   LMRGDQPLLWATQLPYHDGIWLVKSLVAASPAQASVPPIDSPTLEALRGLRGEARYKAW
FT                   SRYFVEALRASPGSCLEAGRWLLRLSLAEQAPAWQPPQSHDSRERVLERWRYRSVGRDA
FT                   LLPDWRFYSLEKVLDDDWVQWLDWWGRDNDALIALRRVEDDEGRVKWWRKKAREGELPP
FT                   VLALRLNCLDACVILDGHCRLRAGLLENVAPEILVLCAYDEQPMPVDTAQRERVLQSLA
FT                   QRVDAPVRRGRRPLDSEQLNQVLLRLFDDRPWPRVLTRARAVLKEEQWCAEVRDWLTAR
FT                   ERLDALEPIIRRVE"
FT   gene            complement(619177..619974)
FT                   /gene="hyi"
FT                   /locus_tag="PA14_07150"
FT   CDS_pept        complement(619177..619974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="PA14_07150"
FT                   /product="putative hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15513"
FT                   /db_xref="GOA:A0A0H2ZLG7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLG7"
FT                   /protein_id="ABJ15513.1"
FT                   /translation="MPRFAANLSMLYPRHDFLDRFAAAAADGYEGVEYLFPYAYPAAEL
FT                   KARLDDHGLRQVLFNAAPGDWDKGERGLASLPGREAEFRRAIAQAIDYAQVLGNRHIHV
FT                   MAGLLPAGADRIRHRETYLDNLAHAAREAAGARLTVLIEPINNRDMPGFFLTRQDDAQA
FT                   ICREVGADNLQVQFDCYHCQIVEGDLATTLRRDIGNIGHVQIAGVPDRHEPDDDNEVNY
FT                   PYLFELLDRLGYQGWIGCEYRPRGDTSAGLEWLRRWRATRRDG"
FT   gene            620189..621250
FT                   /gene="epd"
FT                   /locus_tag="PA14_07170"
FT   CDS_pept        620189..621250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="PA14_07170"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15514"
FT                   /db_xref="GOA:A0A0H2ZL79"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL79"
FT                   /protein_id="ABJ15514.1"
FT                   /translation="MSTPPFRVALNGYGRIGRCVLRALHERPEQLGFEIVALNDLADQA
FT                   SVEYLTRFDSTHGRFPGEVKVDGDCLHINGDCVKVLRSPTPEAIDWQALRVDLVLECSG
FT                   QYTNRAQAERFLRAGAPRVLFSQPMASEADIDATIVYGVNQQDLSGRETLVSNASCTTN
FT                   CGVPLLKLLNEAIGLEYVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGLA
FT                   RGIERLLPELAGRIQAKAIRVPTVNVSALDITLQTSRDTSAAEINRVLREAAESGPLRG
FT                   LLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLAWFDNEWGFANRMLDVAGHY
FT                   LRAAVPDQQVPKD"
FT   gene            621256..622419
FT                   /gene="pgk"
FT                   /locus_tag="PA14_07190"
FT   CDS_pept        621256..622419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PA14_07190"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15515"
FT                   /db_xref="GOA:Q02TL3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TL3"
FT                   /protein_id="ABJ15515.1"
FT                   /translation="MTVLKMTDLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLK
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVAEYLSKALGREVPLLADYLDGVEVKAG
FT                   DLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVARFAKVAAA
FT                   GPLLAAELDALGKALGNPARPMAAIVAGSKVSTKLDVLNSLAGICDQLIVGGGIANTFL
FT                   AAAGHKVGKSLYEADLVETAKAIAAKVKVPLPVDVVVAKEFAESAVATVKAIAEVADDD
FT                   MILDIGPQTAAQFAELLKTSKTILWNGPVGVFEFDQFGEGTRTLANAIADSAAFSIAGG
FT                   GDTLAAIDKYGIAERISYISTGGGAFLEFVEGKVLPAVEILEQRAKG"
FT   gene            622492..622692
FT                   /locus_tag="PA14_07200"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0553"
FT   CDS_pept        622492..622692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLP1"
FT                   /protein_id="ABJ15516.1"
FT                   /translation="MRSVTLPLLMFCLGLAACSGDGGRRPSTCEVISPPDVMVPTEQNR
FT                   QRVEQQSSGDPTAGQKPVECP"
FT   gene            622852..623193
FT                   /locus_tag="PA14_07210"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0554"
FT   CDS_pept        622852..623193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15517"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU2"
FT                   /protein_id="ABJ15517.1"
FT                   /translation="MNYSRIALLGGLAAAALLAGCSGSSGKPGGKDWTRWTCDSKAVIE
FT                   WRYIDGSKNIVDLRLKDEDDVVHHLEQEPAAVGAFYSDGRLGFHLENDEGLVYWVETDD
FT                   LIGRGCKAR"
FT   gene            623313..624377
FT                   /gene="fda"
FT                   /gene_synonym="cbbA"
FT                   /gene_synonym="fba"
FT                   /locus_tag="PA14_07230"
FT   CDS_pept        623313..624377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fda"
FT                   /gene_synonym="cbbA"
FT                   /gene_synonym="fba"
FT                   /locus_tag="PA14_07230"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15518"
FT                   /db_xref="GOA:A0A0H2ZKH3"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH3"
FT                   /protein_id="ABJ15518.1"
FT                   /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMM
FT                   DGSLREDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAE
FT                   GVLDHSQLLTDPEEAADFVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHA
FT                   RIPDTHLVMHGSSSVPQDWLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLR
FT                   LASTGAIRRFLAQNPSEFDPRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGM
FT                   FQRYARGELDPKVN"
FT   gene            624443..624925
FT                   /locus_tag="PA14_07240"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0556"
FT   CDS_pept        624443..624925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH2"
FT                   /protein_id="ABJ15519.1"
FT                   /translation="MRRWLLTLPFLLLAGCAGLHAPSRDVEEAASPSVARDPADPQDCL
FT                   ARSDCTTKTSRTLLFVFDYAEAGGELVVRDGRRLETPPAPQRSTWPALRIQLAEPVNGR
FT                   FEFESPCLRKSGKGCRYSQATLLKVYRSYLVGKPCSLLSPRAVKRCVDPATTAARR"
FT   gene            complement(624927..625583)
FT                   /locus_tag="PA14_07250"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0557"
FT   CDS_pept        complement(624927..625583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07250"
FT                   /product="putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15521"
FT                   /db_xref="GOA:A0A0H2ZLP6"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLP6"
FT                   /protein_id="ABJ15521.1"
FT                   /translation="MRDLLGGRKSPRYSTAAFPRIPDERFKALRGVARSHWSVASWTSR
FT                   GRGYCRSEGPPDDQGKSIPAHAGIPRHNQESAMSSEVSAIRQLIEDWRAAVRASDVPRI
FT                   VSYYAEDIVAFDAILQLQFKGRDAYQKHWQACTEMCKGPMTFDIAELQIHADPQVAFAH
FT                   YLCHCGGTGPDGQPHSSWMRVSAGYRKQGDGWKVIHEHFSAPFDMDGKALFDLQP"
FT   gene            625582..626349
FT                   /locus_tag="PA14_07260"
FT   CDS_pept        625582..626349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15520"
FT                   /db_xref="GOA:A0A0H2ZL84"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL84"
FT                   /protein_id="ABJ15520.1"
FT                   /translation="MSSVHSAAQQGFSAEAQRYAQGRPEYPEALSDWLRDALGLRPQTV
FT                   AVDLGAGTGKFTRLLARTGARVVAVEPVDAMRAQLAEALPQVQALAGSAQSIPLANGFA
FT                   DALVCAQAFHWFATVEALEEMRRVLTAEGRLGLVWNVRDESLDWVAEITRIITPYEGDA
FT                   PRFYKGDWRRPFERAPFGPLRLSTFAYEHVGPPEQVIVSRFLSVSFIAALPETEKNAVA
FT                   AQLRELVASHPALKGKEQVALPYRTEAYLAEAR"
FT   gene            complement(626346..627524)
FT                   /gene="yhiN"
FT                   /locus_tag="PA14_07280"
FT   CDS_pept        complement(626346..627524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiN"
FT                   /locus_tag="PA14_07280"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15522"
FT                   /db_xref="GOA:A0A0H2ZKU8"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU8"
FT                   /protein_id="ABJ15522.1"
FT                   /translation="MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILMS
FT                   GGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLFCD
FT                   NKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYRLRTSAGEMRCESLVIASGGLS
FT                   IPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSCNGQA
FT                   FRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNSELKTL
FT                   LAELFTKKLAGLLADRWFVSKPMKQYTPTELAGIAGQLSAWRVTPSGTEGYRTAEVTLG
FT                   GVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA"
FT   gene            627637..628125
FT                   /gene="ygjP"
FT                   /locus_tag="PA14_07290"
FT   CDS_pept        627637..628125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygjP"
FT                   /locus_tag="PA14_07290"
FT                   /product="putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15523"
FT                   /db_xref="GOA:A0A0H2ZKH8"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH8"
FT                   /protein_id="ABJ15523.1"
FT                   /translation="MIPLKYLQAYPASLQDQVRQLIAENRLGEYLERRYPGRHDVQSDK
FT                   ALYAYTMNLKQEHLRNAPGLDKVLYDNKLDVVQRALGLHTAISRVQGGKLKAKKEIRVA
FT                   SLFKDAAPEFLRMIVVHELAHLKESEHNKAFYQLCQYMLPDYHQLEFDLRVYLTWKSL"
FT   gene            628151..629305
FT                   /locus_tag="PA14_07300"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0561"
FT   CDS_pept        628151..629305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15524"
FT                   /db_xref="GOA:A0A0H2ZLH9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH9"
FT                   /protein_id="ABJ15524.1"
FT                   /translation="MGSASQRSVQDLYEDVGDHYRIFIRAPFFQLLKHRDYWVPLLYFF
FT                   FVLITMFWDLYCHSGQYLYEARSLLPFYLFPFLIAALRIGDIVVDTRCRNVENLGGFER
FT                   SAESSRYVQLSLYERQWFRLRYRAYGGNLRCLAGDLVENWRLWKEVNSKAAKDIDGAVM
FT                   LRFFLPPRDLARLVTLLAALIAVIATLIITLGADRQGYFEFVDNLPAYLKLYWGVVFII
FT                   AFSGPYMIFLGMQARLVLRAMIDALSISQPSDKLFYQFIQRLIWADGVKPANPSANSRV
FT                   LRAVDSMVDFFYEEWRSAIGKLVLWLVALLVLLLCTLLHCLLRVFSSARTLGEALMRIL
FT                   LAVLGGVCWIVAAIQRLNLAVPFHWTFFVLTGTGALFATLCGQP"
FT   gene            complement(629307..629981)
FT                   /locus_tag="PA14_07310"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0562"
FT   CDS_pept        complement(629307..629981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07310"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15525"
FT                   /db_xref="GOA:A0A0H2ZL89"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL89"
FT                   /protein_id="ABJ15525.1"
FT                   /translation="MPHPIDALISDCDGVLVDSEVIAERVMYEALSAYAPLEELQRLLE
FT                   GTFGLTSRDILDRVEKHFGLRIPDSFNREVRQRSEEMVAQVQPIPGAREALLALDLPVA
FT                   VASNSRRHSLERSLARAGLSELIGERLASADMVALPKPAPDVYLHAASLLGVAPERCLV
FT                   VEDSSTGTRAALAAGMRVIGFVGAGHIPAGHAEVLRELGAIAIVEHMRELPETVARLRR
FT                   TV"
FT   gene            complement(630110..630463)
FT                   /locus_tag="PA14_07330"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0563"
FT   CDS_pept        complement(630110..630463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15526"
FT                   /db_xref="GOA:A0A0H2ZLQ2"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLQ2"
FT                   /protein_id="ABJ15526.1"
FT                   /translation="MEWFLKCVKEHYFDFNGRARRKEYWMFTLVNIIISVALSVVLGLI
FT                   SEKLLPIANLYSLAVLLPALGVTARRLHDINKSGWWMLIALIPIVGLYLIYLLAKDSDA
FT                   GQNQYGQNPKGIA"
FT   gene            complement(630641..631552)
FT                   /locus_tag="PA14_07340"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0564"
FT   CDS_pept        complement(630641..631552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07340"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15527"
FT                   /db_xref="GOA:A0A0H2ZKV3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV3"
FT                   /protein_id="ABJ15527.1"
FT                   /translation="MDPLDRLIQLANLQGRLDQRCQLQGSWALEHPQAVPGEATFHIVM
FT                   AGTCYCEFLDGARLDLHPGDLILLPRGTPHLLRSDSPAQPCEPTVEHRGSIPLYQLNGP
FT                   GEALDMLCGSYRYHAGASLFGALPERLLVHMDESTQQPLRALIGLMREEAESTRSGARS
FT                   IIDALATALFALALRAYLDRQPLGDGLFGLLGDARLGRALRAMLERPEHAWTLEQLAQQ
FT                   AAMSRASFVRAFSALGGTSPWILLTRIRMEKARGLLRQTQKSLLDIAAETGYQSEAAFS
FT                   RNFRQAFGESPGRFRRQADSAR"
FT   gene            631670..632008
FT                   /locus_tag="PA14_07355"
FT   CDS_pept        631670..632008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07355"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15643"
FT                   /db_xref="GOA:A0A0H2ZLH8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH8"
FT                   /protein_id="ABJ15643.1"
FT                   /translation="MLNNWTEFVPAVKKAFGALGKQHPKMLAAYGALEEASAEGALDAK
FT                   TRELISIAVAITTRCDGCIGVHTEAALKAGASEAEIAQTLATAISLNAGAAYVYSLRAL
FT                   EAYDQFKK"
FT   gene            complement(631998..632513)
FT                   /locus_tag="PA14_07360"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0566"
FT   CDS_pept        complement(631998..632513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15528"
FT                   /db_xref="GOA:A0A0H2ZKI0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI0"
FT                   /protein_id="ABJ15528.1"
FT                   /translation="MSDLPPRPAFWPYLPGYALLLLSVLLCASGSYRFVTPMALADGVD
FT                   LVYLSQGLALLPLGTGLVGLLAGFLLHVRGRWLGALLALLPATLICAWNLYNYAAHGDE
FT                   ALSPSFAQYTQALLGLLLLGGVLSLVDLLHGRPSTLLRKGLLGLGWLALVAWLGLLFYL
FT                   QRLYGLTF"
FT   gene            632701..632859
FT                   /locus_tag="PA14_07370"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0567"
FT   CDS_pept        632701..632859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15529"
FT                   /db_xref="GOA:A0A0H2ZLI4"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLI4"
FT                   /protein_id="ABJ15529.1"
FT                   /translation="MDLIRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHA
FT                   VYIIAKR"
FT   gene            complement(632869..633327)
FT                   /locus_tag="PA14_07380"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0568"
FT   CDS_pept        complement(632869..633327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL94"
FT                   /protein_id="ABJ15530.1"
FT                   /translation="MELIRNLDDANMGEVYWRLYRRYISLFIENEADDAYAWRCARALD
FT                   ELDDAVVERLCAASLRYRAARLERLGESAEEVAPARGVLERIEPGELIVPDPEQGDEAV
FT                   IHLSLNCEWDREHGMEWIVRGGEVLYVGPFHGEDPWRDFTVKEPWNYA"
FT   gene            complement(633343..633813)
FT                   /locus_tag="PA14_07400"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0569"
FT   CDS_pept        complement(633343..633813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLQ7"
FT                   /protein_id="ABJ15531.1"
FT                   /translation="MIPFGLSTEQFRERYRRDLQRAAPGVIQHLRELLRQPLEEGLRDG
FT                   EIQLFLGEDGRDAAEAWLYLNGASNRVDASDPRLFPGKTLDLALGLGHAPDFDEAYFAD
FT                   GFGGVDLLADTLQAWFAECWWKAGGWAWPIPLWLHVHDGFGDGRGIALTERC"
FT   gene            complement(633827..634174)
FT                   /locus_tag="PA14_07410"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0570"
FT   CDS_pept        complement(633827..634174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15532"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV9"
FT                   /protein_id="ABJ15532.1"
FT                   /translation="MKPELDALEAWLGQPLPAAFVAALEQHGGRLVEPGLLLYAADELL
FT                   ERNRAFETSLYCPGYLAIGDDSGGRAVVMALDDHRQALFLVDHGAMTPDCFEPLAPSLE
FT                   AWLEAGPCLPE"
FT   gene            complement(634164..634778)
FT                   /locus_tag="PA14_07420"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0571"
FT   CDS_pept        complement(634164..634778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15533"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI3"
FT                   /protein_id="ABJ15533.1"
FT                   /translation="MTDRLPCRACGHLILPTTAARNDGLCMPCKGGYRQNIEDGKRFHT
FT                   ERRRYLASPQALYWSALVSRVYDGREGFAGLSPAERSYYAVSVLSGEVHNGGFDQYFGN
FT                   SSGDQYQAARAGLRELEAEDALALLERAAALLFGDAPVPVSQAERQLRMPTWADQPDRD
FT                   CEAALNALDTRFYALADALGERLLAHARHHALFALDEPDEA"
FT   gene            complement(634969..637740)
FT                   /locus_tag="PA14_07430"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0572"
FT   CDS_pept        complement(634969..637740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15534"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR040711"
FT                   /db_xref="InterPro:IPR041549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ2"
FT                   /protein_id="ABJ15534.1"
FT                   /translation="MSLSTTAFPSLQGENMSRSPIPRHRALLAGFCLAGALSAQAATQE
FT                   EILDAALVSGDSSQLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMW
FT                   VLPANPDNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLTQLSGANAAHAPLLKRAVQ
FT                   WLVNGDPGAATAKDFKVSVVGVDKTATLNGLKSAGLQPADAACNALTDASCASTSKLLV
FT                   LGNGASAASLSATVRARLQAGLPILFVHTNGWNQSSTGQQILAGLGLQEGPYGGNYWDK
FT                   DTVPSSRTRTRSVELGGAYGQDPALVQQIVDGSWRTDYDWSKCTSYVGRTTCDDVPGLS
FT                   DFSKRVDVLKGALDAYNQKAQNLFALPGTTSLRLWLLWADAVRQNIRYPMDKAADTARF
FT                   QETFVADAIVGYVREAGAAQKELGSYAGQRQQSMPVSGSEETLTLTLPSAQGFTAIGRM
FT                   AAPGKRLSIRIEDAGQASLAVGLNTQRIGSTRLWNTRQYDRPRFLKSPDIKLQANQSVA
FT                   LVSPYGGLLQLVYSGATPGQTVTVKVTGAASQPFLDIQPGEDSSQAIADFIQALDADKA
FT                   DWLEIRSGSVEVHAKVEKVRGSIDKDYGGDVQRFIRELNEVFIDDAYTLAGFAIPNQAK
FT                   TPAIQQECAVRGWDCDSETLHKLPGTQHINVDQYAQCGGGCSGNPYDQTWGLNPRGWGE
FT                   SHELGHNLQVNRLKVYGGRSGEISNQIFPLHKDWRVLREFGQNLDDTRVNYRNAYNLIV
FT                   AGRAEADPLAGVYKRLWEDPGTYALNGERMAFYTQWVHYWADLKNDPLQGWDIWTLLYL
FT                   HQRQVDKSDWDASKAALGYGTYAQRPGNSGDASSTDGNDNLLLGLSWLTQRDQRPTFAL
FT                   WGIRTSAAAQAQVAAYSFAEQPAFFYANNRTNEYSTVKLLDMSQGSPTWPFP"
FT   gene            complement(638309..638644)
FT                   /locus_tag="PA14_07440"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0573"
FT   CDS_pept        complement(638309..638644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15535"
FT                   /db_xref="GOA:A0A0H2ZL99"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL99"
FT                   /protein_id="ABJ15535.1"
FT                   /translation="MDYSPIVAQVWGMLTWFIPAALLIGLLKSPWAKGQIGELLVRLFA
FT                   HWQLDRQTYRRLHNVTLNTPDGTTQIDHVFFSPYGIFVLETAGFQHLPIGLYRCTGEPC
FT                   CRSQALA"
FT   gene            complement(638737..639858)
FT                   /locus_tag="PA14_07450"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0574"
FT   CDS_pept        complement(638737..639858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15536"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLR2"
FT                   /protein_id="ABJ15536.1"
FT                   /translation="MNDPLWIWQQPDWPQFNWQAEALAPLLRSCSQAQGRLLGMLGAVG
FT                   SDTEVQSSLDAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLHEEGRTTSRSEGLAELL
FT                   LDATHAHQEPLDEQRLFTWHSWLFPTDDQLLARPLHIGALRGEEPMQVVSGRIDRPTVY
FT                   FEAPPRAGLEAQLADFLAWFESSRSDASLDPFLRAGIAHFWFVTLHPFDDGNGRLTRAI
FT                   TDLALAQGEQQAIRFYAMSASILDDRAGYYRILEASQKGGLDITKWLQWFLETLLKSLE
FT                   QALARIDRVLVKARFWQAHRSQTLSAEQIKVLNRLLDGGERGFEDGISAAQYQAVAKVS
FT                   KATATRHLSDLLEKGCIERLPGGGRSTRYQIAR"
FT   gene            complement(640117..640278)
FT                   /locus_tag="PA14_07460"
FT   CDS_pept        complement(640117..640278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW3"
FT                   /protein_id="ABJ15537.1"
FT                   /translation="MATIAPPSRGPQNGLADQRKTFRTKRDAEDWARRTEDEMVRGVYI
FT                   QHCGSERM"
FT   gene            complement(640410..640483)
FT                   /locus_tag="PA14_07470"
FT   tRNA            complement(640410..640483)
FT                   /locus_tag="PA14_07470"
FT                   /product="tRNA-Met"
FT   gene            complement(640581..642266)
FT                   /locus_tag="PA14_07480"
FT   CDS_pept        complement(640581..642266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07480"
FT                   /product="putative reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15538"
FT                   /db_xref="GOA:A0A0H2ZKI8"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI8"
FT                   /protein_id="ABJ15538.1"
FT                   /translation="MKELSPSAGSALSGAPQQWHDIDWCRVQRNVRGMQVRIAKACREG
FT                   KWRRVKALQRMLTRSTSARYLAVRRVTENQGKRTAGVDRVLWDTPDTKWKAAQGLKRRG
FT                   YQPRPLRRVFIPKSNGKERPLGIPTMTDRAMQALYLLALSPIAETTGDPNSYGFRIERS
FT                   TADAMSQLFVCLSGKASAQWILEADIQGCFDHINHDWLLNHVPTDKVILRKWLKAGVIH
FT                   KGQLQATDAGTPQGGIISPTLANMVLDGLESQLKRHLGVTRAKKLKLNVVRYADDFVIT
FT                   GVSPEVLEKEVKPWVEQFLAVRGLQLSLEKTRIAHIDQGFDFLGWNFRKYNGKLLIKPS
FT                   QKNAKAFYGKVKEVIETSRTARQEDLIRTLNPILRGWALYHQPVVAKQTFSRMDNRVFL
FT                   KLWRWAKRRHPNKSLDWIRRRYFRIHGDKTWVFATTVLESNGKKREVALYSLASTPIER
FT                   HRKVSGEYNPYDPAMEAIGEKLRTERMLKKLKYRTQIRNLYLSQKGLCSLCNQPITRET
FT                   GWHDHHILYRSQGGGDSLENRVLLHPACHQQLHARGLTVSKPAR"
FT   gene            complement(643347..647084)
FT                   /locus_tag="PA14_07500"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0575"
FT   CDS_pept        complement(643347..647084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15539"
FT                   /db_xref="GOA:A0A0H2ZLJ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ7"
FT                   /protein_id="ABJ15539.1"
FT                   /translation="MQRLQAVLLLCLACCWPGLAGALTLTPEERAWLAEHPSIRLGVDT
FT                   SWPPFEFRDEQGRYQGLAAGYVSLLQERLGVSLTPVEPKTWTQVLEQAKDGRLDLLPGI
FT                   MATPERQEYLSFTRPYLDFPIIILARKNGPMPKRIDELYGLKVAVVDHYAPHELLIAQH
FT                   PDLTLLPLPSVAAALQALATGQADAFVGDFASSVWNLRQLKLNGLEISGETPYRYQLAM
FT                   AVPRGQPILAGIVDKVLADLSAEEIERLQAPWVGGLLDRRPAWREMATYGLPIVLLILV
FT                   SVAILLAMNRRLRREVSRRRQLERELRDSEQHYRGLVESLNAIAWEMRLEENRFTYVSP
FT                   HAERLLGYPLGEWLQPGFWQRTLHPMDAEYAIHYCMSESQAGRDHSFDYRMLAADGRVV
FT                   WIRDLVTPIAQGRDLLLRGLMIDITEAKLTEQAMRLSEQKFASVFHHCPDMVVLANGAD
FT                   GRFLAVNNTFEQQIGIAADDAIGKTATELGIWALPGLGPQVLEKLGHGNLTNLEVPLRR
FT                   RNGSTFSALLSAQHVALDQTPALVVVIRDITHLVETQELLRISEEKFANAFHAYPDGLL
FT                   ISRLEDGTLIDVNEGFTRLTGYRRDEVISRSTLELGLWVDTEDRKRLISLVRHHTLTQG
FT                   FTAPVRDRNGGIRQCEMSAHRISIDGEDCVLTIARDITERQLMQEKLQQAATVFESTAE
FT                   GVMITDTRQRITAVNRAFSEITGYSEQEALGRSPSLLSSGQHDSSFYLAMWNQLERDGH
FT                   WQGEIWNRRKTGELYPEWLTISAVHNPQGEITHFVGVFADISTLKYAQARLDYQAHHDP
FT                   LTGLPNRLLFESRLNHALDEAREESRPGAVLFIDLDRFKHINDSLGHPIGDLLLKAIAE
FT                   RLRDQLRDVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNAFTAPFQAEGHEFFVSA
FT                   SVGIALFPKDGDDAPTLVKNADAAMYRAKSRGRSRIEYYTRELTYLATERMALETELRR
FT                   ALERDELQLYYQPKLSLESGLLVGAEALVRWYHPLFGEISPERFIPLAEDCGLILPLGD
FT                   WVLGHACQQMGEWQKLHAPFGPLSVNLAGAQLGQPQLIERLEQLLEQSGLEPSRLQLEI
FT                   TESFIMNQTEEALAVLHGLKRLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGL
FT                   PDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFLTHEGCEQIQGFVLSPPLPAEL
FT                   FASKFLKPRQPIGAPREAPV"
FT   gene            complement(647191..649044)
FT                   /gene="rpoD"
FT                   /locus_tag="PA14_07520"
FT   CDS_pept        complement(647191..649044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="PA14_07520"
FT                   /product="sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15540"
FT                   /db_xref="GOA:A0A0H2ZLA4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA4"
FT                   /protein_id="ABJ15540.1"
FT                   /translation="MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVED
FT                   IIRMINDMGINVFETAPDADALLLAEADTDEAAAEEAAAALAAVESDIGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFPGTVDSILADYNRIVAEGGRLSDV
FT                   LSGYIDPDDGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDSSDSDDEGDGGPDPEEAR
FT                   LRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVARVRSAL
FT                   EGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPKYAEAIERLRDD
FT                   ILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARRAKKEMVEANLRLVISIAKKYT
FT                   NRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV
FT                   HMIETINKLNRISRQMLQEMGREPTPEELGERMDMPEDKIRKVLKIAKEPISMETPIGD
FT                   DEDSHLGDFIEDSTMQSPIEMATSESLKESTREVLAGLTAREAKVLRMRFGIDMNTDHT
FT                   LEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE"
FT   gene            complement(649124..651118)
FT                   /gene="dnaG"
FT                   /locus_tag="PA14_07530"
FT   CDS_pept        complement(649124..651118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PA14_07530"
FT                   /product="putative DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15541"
FT                   /db_xref="GOA:A0A0H2ZLR9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLR9"
FT                   /protein_id="ABJ15541.1"
FT                   /translation="MAGLIPQSFIDDLLNRTDIVEVVSSRIQLKKTGKNYSACCPFHKE
FT                   KTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDQLEFPQAVEELAKRAGMDVPREERGG
FT                   RGHTPRQPTDSPLYPLLSAAAEFYKQALKSHPARKAAVNYLKGRGLTGEIARDFGLGFA
FT                   PPGWDNLLKHLGGDNLQLKAMLDAGLLVENSDTGKRYDRFRDRVMFPIRDSRGRIIAFG
FT                   GRVLGDDKPKYLNSPETPVFHKGQELYGLYEARQKNRDLDEIMVVEGYMDVIALAQQGI
FT                   RNAVATLGTATSEEHIKRLFRLVPSILFCFDGDQAGRKAAWRALESVLPNLQDGKRVRF
FT                   LFLPEGEDPDSLVRAEGEDAFRARITQQAQPLAEYFFQQLMLEADPATLEGKAHLATLA
FT                   APLLEKIPGNNLRLLMRQRLSEITGLSGENIGQLAHHSPPPSSMDHGASGVLDGDDYFA
FT                   ASAYYENEPSHAPFDAAPGYGEAQPRKSWNKDKKPWDGKKWDGKKKWDKGGRGDFKAPQ
FT                   RTPVSVESTTLNALRTLLHHPQLALKVDDAGTLAREQDTYAQLLVSLLEALQKNPRQSS
FT                   MQLIARWHGTPQGRLLQALGEKEWLIVQENLEKQFFDTITKLSESQRFGEREERLRSVM
FT                   QKSYSELTDEEKALLREHYSVAASSPSQS"
FT   gene            complement(651201..651650)
FT                   /locus_tag="PA14_07550"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0578"
FT   CDS_pept        complement(651201..651650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15542"
FT                   /db_xref="GOA:A0A0H2ZKW8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW8"
FT                   /protein_id="ABJ15542.1"
FT                   /translation="MSEIKSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERIEV
FT                   DDARALLILDRMIKQRRDAQRQFSDAGRQDLAEVEAAEILVLQDFMPKPLDDHEINALI
FT                   ERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARLSS"
FT   gene            complement(651720..651935)
FT                   /gene="rpsU"
FT                   /locus_tag="PA14_07560"
FT   CDS_pept        complement(651720..651935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PA14_07560"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15543"
FT                   /db_xref="GOA:Q02TI4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TI4"
FT                   /protein_id="ABJ15543.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAER
FT                   KRKAAAAVKRHAKKVQREQRRRERLY"
FT   gene            652136..653161
FT                   /gene="gcp"
FT                   /gene_synonym="yjgD"
FT                   /locus_tag="PA14_07570"
FT   CDS_pept        652136..653161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /gene_synonym="yjgD"
FT                   /locus_tag="PA14_07570"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15544"
FT                   /db_xref="GOA:Q02TI3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TI3"
FT                   /protein_id="ABJ15544.1"
FT                   /translation="MRVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVYGGVVPE
FT                   LASRDHVKRMLPLIRQVLDESGCTPADIDAIAYTAGPGLVGALLVGASCAQAVAFAWGV
FT                   PAVGVHHMEGHLLAPMLEEQPPRFPFVALLVSGGHTQLVRVDGIGRYQLLGESVDDAAG
FT                   EAFDKTAKLIGLGYPGGPEIARLAERGTPGRFVFPRPMTDRPGLDFSFSGLKTFTLNTW
FT                   QRCVEAGDDSEQTRCDIALAFQTAVVETLLIKCRRALKQTGLKNLVIAGGVSANQALRS
FT                   GLEKMLGEMKGQVFYARPRFCTDNGAMIAYAGCQRLLAGQHDGPAISVQPRWPMESLPA
FT                   V"
FT   gene            complement(653240..653809)
FT                   /locus_tag="PA14_07580"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0581"
FT   CDS_pept        complement(653240..653809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07580"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15545"
FT                   /db_xref="GOA:Q02TI2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TI2"
FT                   /protein_id="ABJ15545.1"
FT                   /translation="MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNMLR
FT                   VAGKKLAILTLLGDVGKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGGKG
FT                   VATAAGMLLGLYPPAVLLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGALLPM
FT                   TVLTGLIVWRHRANLRDLFAGRERHF"
FT   gene            653893..654246
FT                   /gene="folB"
FT                   /locus_tag="PA14_07590"
FT   CDS_pept        653893..654246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="PA14_07590"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15546"
FT                   /db_xref="GOA:A0A0H2ZKJ2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ2"
FT                   /protein_id="ABJ15546.1"
FT                   /translation="MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGD
FT                   DLALALDYAALSERVQEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPA
FT                   ARGVGVEIERGCR"
FT   gene            654237..654779
FT                   /gene="folk"
FT                   /locus_tag="PA14_07600"
FT   CDS_pept        654237..654779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folk"
FT                   /locus_tag="PA14_07600"
FT                   /product="putative
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15547"
FT                   /db_xref="GOA:A0A0H2ZLK2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLK2"
FT                   /protein_id="ABJ15547.1"
FT                   /translation="MSLIPVYLGLGSNVERERHLRAGLDALAGFLHDLRCSPVFESEPV
FT                   GIKSGPFFNLVVSARTDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLFYGDLVGD
FT                   FDGLVLPRAEVLKNAFVLWPLSELAPNLEHPVARQPLGDLWRETRIQQKLWPAPFEWRG
FT                   QALTPEALLQAFPRSSL"
FT   gene            complement(654752..655984)
FT                   /gene="cca"
FT                   /locus_tag="PA14_07620"
FT   CDS_pept        complement(654752..655984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="PA14_07620"
FT                   /product="tRNA nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15548"
FT                   /db_xref="GOA:Q02TH9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH9"
FT                   /protein_id="ABJ15548.1"
FT                   /translation="MQIYKVGGAVRDRLLGRPVTDIDWVVVGASSDEMLARGYRPVGAD
FT                   FPVFLHPQSGEEYALARTERKSGRGYGGFTFHASPEVTLEEDLTRRDLTINAMAEDEQG
FT                   RVIDPYGGQADLEARLLRHVSPAFAEDPLRVLRVARFAARYAGLGFRIAAETLALMRQL
FT                   AESGELQALTPERSWKEISRALMEPNPEVFIQVLHDCGALAELIPEVEALFGVPQPAAH
FT                   HPEIDTGVHVLSVLQQCARHRQPLSVRWACLLHDLGKGLTSEADWPRHIAHEARGVPLI
FT                   DAVNQRFRVPRDCQELARLVGEYHTHAHRALELRPNTLLELLQSFDVYRRPQRFEEFVA
FT                   ASEMDARGRLGLEQRDYPQAAYLLGAAQAARAVSVKPLVEKGLKGAELGEALKRARLAA
FT                   LKAYKEERGKA"
FT   gene            complement(656028..656534)
FT                   /locus_tag="PA14_07630"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0585"
FT   CDS_pept        complement(656028..656534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15549"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB0"
FT                   /protein_id="ABJ15549.1"
FT                   /translation="MRLFAIVLLCLVLATCASHIPSARVTHPASAGLPGLQGFQLMPPE
FT                   QAVDALPYRNRYPLINAELRQGLAAHGYHESATPQFRVYYWLALRDAPLEFRPDLPPTS
FT                   GMGPYLAIHRLRDETGTLRVRLVDLEERVLWEGMVSTGLSPARANPEQLELVVGALLRQ
FT                   LPRAR"
FT   gene            complement(656629..658182)
FT                   /gene="ycgB"
FT                   /locus_tag="PA14_07650"
FT   CDS_pept        complement(656629..658182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="PA14_07650"
FT                   /product="putative sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15550"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLS6"
FT                   /protein_id="ABJ15550.1"
FT                   /translation="MSKRQPIATGSEWTFELIQQYDREISRIAERYALDTYPNQIEVIT
FT                   AEQMMDAYASVGMPIGYNHWSYGKHFLSTEKNYKRGQMGLAYEIVINSDPCIAYLMEEN
FT                   TQCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERYGIDAVE
FT                   DLLDSCHALMNYGVDRYKRPYPISAEEERQRQKEREELIQRQVNDLWRTIPRVGGKDKE
FT                   QSMARYPSEPQENILYFIEKNAPLLEPWQREVIRIVRKIAQYFYPQRQTQVMNEGWATF
FT                   WHYTLLNDLYDEGLVNDGFMMEFLQYHTSVVYQPSFDSPYYSGINPYALGFAMYRDIRR
FT                   ICEEPTDEDRRWFPDIAGSDWLATLKFAMKSFKDESFILQFLSPKVIRDLKLFSILDDD
FT                   QKDDLLVAAIHDEAGYRTIRETLAAQYNLGNREPNIQIWNVDRRGDRSLTLRHQQFDRQ
FT                   PLSDSTADVLKHLHRLWGFDIHLETLQGDQLVQTHHMPPKGASEGEEGYPRLDLIIPPI
FT                   "
FT   gene            complement(658179..659450)
FT                   /locus_tag="PA14_07660"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0587"
FT   CDS_pept        complement(658179..659450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15551"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH6"
FT                   /protein_id="ABJ15551.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSITD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGRQTVVHPGNKEFTAGEHIARPSGGGGGRGGGKAS
FT                   NSGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHITGTDTFKTVRAGISNDGNPSRIN
FT                   IVRTLRSAHARRIALSGGSRAKLRAALKELERIKREEPDNLGDIQELELEIAKLRARID
FT                   RVPFLDTFDLKYNLLVKQPNPTSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRN
FT                   YEKIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKMMQEIMAERYPTHEWNIYAA
FT                   QASDGDNWNDDSPVCRDILLKQIMPFVQYYTYVEITPREHQALWFEYERVREAFEDSFA
FT                   QQQIVSASDIYPVFRELFQRRLVA"
FT   gene            complement(659551..661473)
FT                   /gene="prkA"
FT                   /locus_tag="PA14_07680"
FT   CDS_pept        complement(659551..661473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="PA14_07680"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15552"
FT                   /db_xref="GOA:A0A0H2ZKX3"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX3"
FT                   /protein_id="ABJ15552.1"
FT                   /translation="MSIFSHFQERFEATRQEEYSLQEYLDLCKQDKTAYASAAERLLMA
FT                   IGEPELLDTSVDSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVAFFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNPDEDGAILEEDYGI
FT                   PRRYLRSIMSPWATKRLNEFGGDISQFRVVKLYPSILNQIAIAKTEPGDENNQDISALV
FT                   GKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGALPYSGIILAHSNESEWHSFRNNKNNEAFIDRIYIVKVPYCLRVADEIKIYDK
FT                   LLVNSSLAHAHCAPDTLKMLSQFSVLSRLKEPENSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMAGLSTRFAFKILSKVFNFDPHEVAANPVHLLYVLEQQIEQEQFQPE
FT                   TRERYLRFIKEYLAPRYVEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRAALNEELEKIEKPAGISNPKDFRNEIVNFVLRARAGNNGKNPSWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVKRMVERGYTEKQVRLLSEWYLR
FT                   VRKSQ"
FT   gene            complement(661752..662084)
FT                   /gene="glpE"
FT                   /locus_tag="PA14_07690"
FT   CDS_pept        complement(661752..662084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="PA14_07690"
FT                   /product="putative thiosulfate/cyanide sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15553"
FT                   /db_xref="GOA:Q02TH4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH4"
FT                   /protein_id="ABJ15553.1"
FT                   /translation="MSDTFQRIAPEQARQLRENGAQVVDIRDPQSFAVGHISGSRHIDN
FT                   HSVADFIAAADLDAPLVVVCYHGNSSQSAAAYFIQQGFSDVYSLDGGFELWRSVYPADT
FT                   SSGEAE"
FT   gene            complement(662128..662979)
FT                   /gene="apaH"
FT                   /locus_tag="PA14_07700"
FT   CDS_pept        complement(662128..662979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="PA14_07700"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15554"
FT                   /db_xref="GOA:Q02TH3"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH3"
FT                   /protein_id="ABJ15554.1"
FT                   /translation="MAVYAVGDLQGCLDPLKCLLERVAFDPAKDRLWLVGDLVNRGPQS
FT                   LETLRFLYAMRESVVSVLGNHDLHLLAVAHKSERLKKSDTLREILEAPDREPLLDWLRR
FT                   LPLLHYDEQRKVALVHAGIPPQWSLEKARLRAAEVEQALRDDQRLPLFLDGMYGNEPAK
FT                   WDKKLHGIDRLRVITNYFTRMRFCTEDGKLDLKSKEGLDTAPPGYAPWFSFPSRKTRGE
FT                   KIIFGHWAALEGHCDEPGLFALDTGCVWGARMTLLNVDSGERLSCDCAEQRAPARPAAT
FT                   PA"
FT   gene            complement(662979..663359)
FT                   /gene="apaG"
FT                   /locus_tag="PA14_07710"
FT   CDS_pept        complement(662979..663359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="PA14_07710"
FT                   /product="putative apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15555"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH2"
FT                   /protein_id="ABJ15555.1"
FT                   /translation="MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQ
FT                   LLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLG
FT                   SDGIAFDAAIPVFRLAVPGALH"
FT   gene            complement(663396..664202)
FT                   /gene="ksgA"
FT                   /locus_tag="PA14_07730"
FT   CDS_pept        complement(663396..664202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="PA14_07730"
FT                   /product="rRNA (adenine-N6,N6)-dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15556"
FT                   /db_xref="GOA:A0A0H2ZKJ5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ5"
FT                   /protein_id="ABJ15556.1"
FT                   /translation="MSELYQHRARKRFGQNFLHDAGVIHRILRAIHAREGQRLLEIGPG
FT                   QGALTEGLLGSGARLDVIELDQDLIPLLKLKFGLESRFSLHQGDALKFDFASLVESGEK
FT                   LRVVGNLPYNISTPLIFHLLEHAPVIEDMHFMLQKEVVERLAATPGGGDWGRLSIMVQY
FT                   HCRVEHLFNVGPGAFNPPPKVDSAIVRLTPFAEPPHPARDPKLLERVVREAFNQRRKTL
FT                   RNTLKPLLSVEDIEAAEVDPTLRPEQLDLAAFVRLANRLAELPGNR"
FT   gene            complement(664318..665304)
FT                   /gene="pdxA"
FT                   /locus_tag="PA14_07740"
FT   CDS_pept        complement(664318..665304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="PA14_07740"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15557"
FT                   /db_xref="GOA:A0A0H2ZLL0"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLL0"
FT                   /protein_id="ABJ15557.1"
FT                   /translation="MSLRFALTPGEPAGIGPDLCLLLARSAQPHPLIAIASRTLLQERA
FT                   GQLGLAIYLKDVSPAAWPERPAKAGQLYVWDTPLAAPVRPGQLDRANAAYVLETLTRAG
FT                   QGCLDGHFAGMITAPVHKGVINEAGIPFSGHTEFLADLTHTAQVVMMLATRGLRVALAT
FT                   THLPLREVADAISDERLARVARILHADLRDKFGIAHPRILVCGLNPHAGEGGHLGREEI
FT                   EVIEPCLERLRGEGLDLIGPLPADTLFTPKHLEHCDAVLAMYHDQGLPVLKYKGFGAAV
FT                   NVTLGLPIIRTSVDHGTALDLAGSGRIDSGSLQVALETAYQMAASRC"
FT   gene            complement(665301..666593)
FT                   /gene="surA"
FT                   /locus_tag="PA14_07760"
FT   CDS_pept        complement(665301..666593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="PA14_07760"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15558"
FT                   /db_xref="GOA:A0A0H2ZLB3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB3"
FT                   /protein_id="ABJ15558.1"
FT                   /translation="MKIKLCNRLRPLALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQS
FT                   QLDQRLREVHQTLLKRGAPLPPEHVLTQQVLERLIIENIQQQIGDRSGIRISDEELNQA
FT                   MGTIAQRNGMSLEQFQAALTRDGLSYADAREQVRREMVISRVRQRRVAERIQVSEQEVK
FT                   NFLASDMGKIQLSEEYRLANILIPVPEAASSDVIQAAARQAQELYQQLKQGADFGQLAI
FT                   SRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSLAVGDVTEPVRTPGGFIILKLEEKRGG
FT                   SKMVRDEVHVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALN
FT                   GGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQ
FT                   AVSVLRNRKYDEELQAWLRQIRDEAYVEIKQ"
FT   gene            complement(666574..669348)
FT                   /gene="ostA"
FT                   /gene_synonym="imp"
FT                   /locus_tag="PA14_07770"
FT   CDS_pept        complement(666574..669348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /gene_synonym="imp"
FT                   /locus_tag="PA14_07770"
FT                   /product="organic solvent tolerance protein OstA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15559"
FT                   /db_xref="GOA:Q02TG8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TG8"
FT                   /protein_id="ABJ15559.1"
FT                   /translation="MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQAADQFDCKVSATG
FT                   GWDCSPLQNANANLPPRPAHTATSVSTAAAGSSVSGSGGETVEAEPTQRLVTESGGRAL
FT                   RSRSADYSHLDWIPREKLTAAQLAEIGPYCGGSYIEPVRPGMDDGAPSDESPTYVSAKA
FT                   SRYEQEKQIATLAGDVVLRQGSMQVEGDEANLHQLENRGELVGNVKLRDKGMLVVGDHA
FT                   QVQLDNGEAQVDNAEYVIHKAHARGSALYAKRSENAIIMLKDGTYTRCEPSSNAWTLKG
FT                   NNVKLNPATGFGTATNATLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSSTSDTGFTL
FT                   VTPYYFNLAPNYDATLYPRYMAKRGMMLEGEFRYLTHSSEGIVNAAYLNDKDDHREGFP
FT                   DYSKDRWLYGLKNTTGLDSRWLAEVDYTRISDPYYFQDLDTDLGVGSTTYVNQRGTLTY
FT                   RGDTFTGRLNAQAYQLATTTDVTPYDRLPQITFDGFLPYNPGGMQFTYGTEFVRFDRDL
FT                   DENIYFNDDGSIRGKRPDASLQGLARATGDRMHLEPGMSLPMTRSWGYVTPTLKYLYTK
FT                   YDLDLDSQGKTDLNKRDESFDSNQDRSLPLVKVDSGLYFDRDTTFAGTPFRQTLEPRAM
FT                   YLYVPYKDQDSLPVFDTSEPSFSYDSLWRENRFTGKDRIGDANQLSLGVTSRFIEENGF
FT                   ERASISAGQIYYFRDRRVQLPGLTEKDLKRLNLDPSGLDNDSWRSPYAFAGQYRFNRDW
FT                   RINSDFNWNPNTSRTESGSAIFHYQPEVDPGKVVNVGYRYRADARRFDSSRGTFRYGNE
FT                   DDIIKQHDFSVIWPLVPQWSVLARWQYDYNKNRTLEAFGGFEYDSCCWKLRLINRYWLD
FT                   VDDDAFLVQSEKADRGIFLQIVLKGLGGIVGNKTEMFLDKGIQGYRQREDQAM"
FT   gene            669475..670491
FT                   /locus_tag="PA14_07780"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0596"
FT   CDS_pept        669475..670491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07780"
FT                   /product="putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07780"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15560"
FT                   /db_xref="GOA:A0A0H2ZLT0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLT0"
FT                   /protein_id="ABJ15560.1"
FT                   /translation="MSDDARFQQLNRWLDSCLPELFVAEGWGEVPPAELIPASSDASFR
FT                   RYFRWQGGDRSLVVMDAPPPQEDCRPFVKVAGLLAGAGVHVPRILAQDLENGFLLLSDL
FT                   GRQTYLDVLHPGNADELFEPALDALIAFQKVDVAGVLPAYDEAVLRRELQLFPDWYLAR
FT                   HLGVELEGETLARWQRICDLLVRSALEQPRVFVHRDYMPRNLMLSEPNPGVLDFQDALH
FT                   GPVTYDVTCLYKDAFVSWPEPRVHAALSRYWKKATWAGIPLPPSFEDFLRASDLMGVQR
FT                   HLKVIGIFARICHRDGKPRYLGDVPRFFRYLETAVARRPELAELGELLASLPQGAEA"
FT   gene            670488..671162
FT                   /locus_tag="PA14_07790"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0597"
FT   CDS_pept        670488..671162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07790"
FT                   /product="putative nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15561"
FT                   /db_xref="GOA:A0A0H2ZKX8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX8"
FT                   /protein_id="ABJ15561.1"
FT                   /translation="MKAMILAAGRGERMRPTTLHTPKPLIEAAGVPLIERQLLALRQAG
FT                   VDDWVINHAWLGEQIEAYLGDGSRLGGRIAYSPEGEPLETGGGIFRALPLLGEQPFLLL
FT                   NGDVWSDFDYSRLHLADGDLAHLVLVDNPAHHPAGDFHLDAGGRVGETREAGGNLTYSG
FT                   IAVLHPALFEGCQPGAFKLAPLLRKAIAAGRVSGEHYRGQWVDVGTHERLAEVERLLAE
FT                   HA"
FT   gene            671164..671922
FT                   /gene="djlA"
FT                   /locus_tag="PA14_07800"
FT   CDS_pept        671164..671922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="PA14_07800"
FT                   /product="putative DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15562"
FT                   /db_xref="GOA:A0A0H2ZKJ9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ9"
FT                   /protein_id="ABJ15562.1"
FT                   /translation="MLWPATLIGAGAGWALASIPGALLGGLLGQLLDRRLRLESWRGLL
FT                   ARLRGRAVNDEDDLLFQLLGYLAKSGGRVEEMHIRQAREEMALRKLDRRAQRRAIASFG
FT                   KGKAGIAHLQAEVARLKGERAEAVLLACWRMAWAGGVLSQSARQLVLQWGRWLGWSAER
FT                   TERLSARVMPKRTRAVARDSYREALLLLGVEAGSEPALIKRAYRKLISQHHPDKLAGAG
FT                   ASVERVRAATEKTRELQAAYALVREREGFR"
FT   gene            complement(671923..672984)
FT                   /locus_tag="PA14_07810"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0599"
FT   CDS_pept        complement(671923..672984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15563"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLL6"
FT                   /protein_id="ABJ15563.1"
FT                   /translation="MPAFSLLPKPSALLPLLLAAAFLPPAFVQAEEEAAKDQPPAPVER
FT                   PAVSERSQDEAKGLERQLPEDGQQILKAGDESFLTLWLPANTAEAEGVVILVPGDGESP
FT                   DWPQAIGPLRRKLPDAGWQTLSLALPDPQSTAPVTRPAESAASASADKDASAADSASKP
FT                   DVKGESGNAPAPESTAEAGSGEPAQSEDQAPPPAIDPVEQRKAHAERVMARLQASIDLA
FT                   LQHEPKSVVLLGHGTGAYWAARYLAEKEPAEIHNLLLVAAEVPRDFRPALEDMVPKLKL
FT                   ATGDFYYRDARADREAARLRMQAGKRQKHPAYVQIAMQALPADPKAEQEQLYRRIRGWL
FT                   SLHLQADAQKPAE"
FT   gene            673136..675529
FT                   /locus_tag="PA14_07820"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0600"
FT   CDS_pept        673136..675529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07820"
FT                   /product="putative histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15564"
FT                   /db_xref="GOA:A0A0H2ZLB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB8"
FT                   /protein_id="ABJ15564.1"
FT                   /translation="MLRRCCLLFFCLLLSLPVRAEESVALPLTAELRTWLAEHRELRVG
FT                   VVTEAPYAQYDRRLQQYSGANVELMGWLATAMQVTLRWQGYPDQAALDDALRAGRVDIA
FT                   PGLSQTPAGLRLWLFSDPYLRVSRLVVGKRDGSGSVELEQLERDTRVAVRAGSSVADYL
FT                   SSTYSSLQWVSADSEREVLRAVLAGQARYAVIDEAQLSRLTREPEFAELAVVGDIGYPQ
FT                   LLRVATRRDWPELAMVVDQALRSLPRKSLDQLHERWLQPKYPRLGESPGFWQNLSILLG
FT                   LLLAGALAAVFLQRRQQHALEARLYGARRDLELRQAAEEALRLTQFSIDNSTLGILWVN
FT                   WDSRVRYANRAAEQMLGHADGQLVDRPLADFEPGLDMDRWLNLWRRARNSEEGPLSFET
FT                   RCLRADGSWLPADVSLSFLRFGTSEYLVVFLSDVTERRRAREALQESEARMKGIASNVP
FT                   GMVFRLERPRAGAFSDFAYISEGSEALVGYSALELIESGRGIRGLVHPDDRERYWSSQM
FT                   AALDENRDWHWQGRILTRQGELRWADIKASARCFEDGRAVWDGVVWDITANKQIELELG
FT                   ESRAQLRELSAHLESVREEEKARIAREVHDELGQVLTVLKLETSMCELAYADAQEGLRE
FT                   RLGNMKKLIAQLFQLVRDVATALRPPILDAGIGSAVEWQARRFEARTQIPCLVEVPENS
FT                   PQLVDAKAIGLFRILQEALTNVMRHAEAHTVQLRLLREGDELCLSVSDDGRGFDVATVG
FT                   RGSSFGLVGMRERVLMMGGTLDIDSAPGEGTTLSVRIPLGVASP"
FT   gene            675575..676207
FT                   /gene="uhpA"
FT                   /locus_tag="PA14_07840"
FT   CDS_pept        675575..676207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpA"
FT                   /locus_tag="PA14_07840"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15565"
FT                   /db_xref="GOA:A0A0H2ZLT6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLT6"
FT                   /protein_id="ABJ15565.1"
FT                   /translation="MVIRVLVAEDHTIVREGIKQLIGMAKDLQVVGEATNGEQLLETLR
FT                   GTPCEVVLLDISMPGVNGLEAIPRIRALNEPPAILVLSMHDEAQMAARALKIGAAGYAT
FT                   KDSDPALLLTAIRRVAGGGRYIDPDLADRMVFEVGLTDSRPPHALLSEREFSVFERLVQ
FT                   GANVNEIAQQLAVSNKTISTHKARLMQKLNAHSVADLVRYAMEHRLL"
FT   gene            676336..677370
FT                   /locus_tag="PA14_07850"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0602"
FT   CDS_pept        676336..677370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07850"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15566"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY3"
FT                   /protein_id="ABJ15566.1"
FT                   /translation="MLPAMRTGLLCALLGVTAPAWAEYVTVISFGGANKEAQETAFYKP
FT                   FKSATGNRVVHGSYNGDLAKLKRMVEISHVSWDVVEVEAPELARGCEEGLFEKLDMAKV
FT                   GDPADFVPGAVQPCGVGIFVWTTLLAYNPGKVAGSPQGWADFWDVKKFPGKRGLRWGAK
FT                   YSLEFALMADGVAPKDVYQTLATPAGVERAFRKLDELKPYIHWWKSGQDPVRDLADGTV
FT                   VMSSAYNGRIAAAQAEKQPLAMVWSGGVYDFDFWALPVGVWKKQLAEEFIRFASQPEQQ
FT                   KAFAENIAYGPANRKAVGLLDPQVAASLPTAPQNMQNAVGMNVAFWAEHGEALEQRFQN
FT                   WAKR"
FT   gene            677604..678713
FT                   /locus_tag="PA14_07860"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0603"
FT   CDS_pept        677604..678713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07860"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15567"
FT                   /db_xref="GOA:A0A0H2ZKK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK4"
FT                   /protein_id="ABJ15567.1"
FT                   /translation="MAETQGGDVLVSFRGVQKSYDGETLIVKDLNLDIRKGEFLTLLGP
FT                   SGSGKTTSLMMLAGFETPTAGEILLAGRSINNVPPHKRDIGMVFQNYALFPHMTVAENL
FT                   AFPLSVRGMSKTDVKERVKRALSMVQLDAFAGRYPAQLSGGQQQRVALARALVFEPQLV
FT                   LMDEPLGALDKQLREHMQMEIKHLHQRLGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQ
FT                   IEPPRNLYEQPRNTFVANFIGENNRLSGQLLSCDGERCVVGLPRGEKVEALAVNVGQPG
FT                   EPVTLSIRPERVRLNGASESCVNRFSGRVAEFVYLGDHVRVRLEVCGRDDFFVKQPIAE
FT                   LDPTLSVGDVVPLGWQVEHVRALDPLPAA"
FT   gene            678769..679815
FT                   /locus_tag="PA14_07870"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0604"
FT   CDS_pept        678769..679815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07870"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15568"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLM1"
FT                   /protein_id="ABJ15568.1"
FT                   /translation="MSKSLKAASLKFATLAAGLACAAQAMAVDLTVVSFGGANKSAQIK
FT                   AFYEPYQKATGNRIVAGEYNGEMAKVKAMVDTNSVSWDLVEVESPELSRGCDEGLFEEL
FT                   DPAQFGKTEDFVPGAIQPCGVGFFVWSTVLAYNADKLKSAPTSWADFWDIKKFPGKRGL
FT                   RKGAKYTLEFALMADGVAPKDVYGVLATKEGQDRAFKKLDEIKSSIQWWEAGAQPPQYL
FT                   ASGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKKQEETLKFIAFSVQ
FT                   PQQQKTYSENIAYGPANKQAVPLLDKALLKDMPTTPENIQNQVAMDVTFWADYGEQLEQ
FT                   RFNAWAAR"
FT   gene            679930..681177
FT                   /locus_tag="PA14_07890"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0605"
FT   CDS_pept        679930..681177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07890"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15569"
FT                   /db_xref="GOA:A0A0H2ZLC2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC2"
FT                   /protein_id="ABJ15569.1"
FT                   /translation="MATAVPMSQATGSTLKQRLARAERMNRLKSQALILPLLAFLVLTF
FT                   LVPIAALLYKSVSNPEVVRSLPLTVEAISAWDGKSLPADAVYKALSQDLAEARRNQAIG
FT                   DLSKRLNMELAGYRSLMAKTARKLPFKEEPASYKDAMEQLDERWGDPAYWQVIRRNASS
FT                   YTPYYLLAALDHRIDDLGEVARATPDQAIYLDIFARTFWMGAVITVICLLLAYPLAYLL
FT                   ANLPTRKSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINGALLKLGLIDQPLQLVFN
FT                   RTGVYIAMVHIMLPFMILPIYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQTVAGVG
FT                   AGCLLVFILSIGYYITPALLGSPNDQMVSYFVAFYTNSTINWGMATALGGLLLLATLVL
FT                   YVVYSWLVGASRLRLG"
FT   gene            681283..682113
FT                   /locus_tag="PA14_07900"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0606"
FT   CDS_pept        681283..682113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07900"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15570"
FT                   /db_xref="GOA:A0A0H2ZLU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLU0"
FT                   /protein_id="ABJ15570.1"
FT                   /translation="MLSPYMSPVERLWFYSLRILCGLVLLFLVLPVLVIVPLSFNSGTF
FT                   LVYPLQGFSLRWYADFFQSAEWMRSLTNSMIVAPAATLLAMVFGTLAAIGLTRGEFRGK
FT                   ALVMSLMISPMVVPVVIIGVASYLFFAPLGLGNSYLSLIVVHAVLGVPFVIITVSATLQ
FT                   GFNYNLVRAAASLGAPPLTTFFRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQ
FT                   ATLPRQMFSGIRENLSPTIAAAATLLIGFSVLLLLTLEWLRGRSEKMRTAQPGA"
FT   gene            682237..682911
FT                   /gene="rpe"
FT                   /locus_tag="PA14_07910"
FT   CDS_pept        682237..682911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="PA14_07910"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15571"
FT                   /db_xref="GOA:A0A0H2ZKY8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY8"
FT                   /protein_id="ABJ15571.1"
FT                   /translation="MQPFAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCSALRKYGVSAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEASQHIDRSLQ
FT                   LIRDGGCKAGLVFNPATPLEVLKYVMDKVDMVLLMSVNPGFGGQKFIPGTLDKLREARA
FT                   LIDASGREIRLEIDGGVNVKNIREIAAAGADTFVAGSAIFNAPDYAEVIRAMHAELAQA
FT                   HQ"
FT   gene            682911..683729
FT                   /gene="gph"
FT                   /locus_tag="PA14_07930"
FT   CDS_pept        682911..683729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="PA14_07930"
FT                   /product="putative phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15572"
FT                   /db_xref="GOA:A0A0H2ZKK7"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK7"
FT                   /protein_id="ABJ15572.1"
FT                   /translation="MSAAEPFFATRLPRLVMFDLDGTLVDSVPDLTAAVDSMLASLGRP
FT                   PAGIEKVRQWIGNGARVLVRRALAGSIEHDGIGEEETEAALALFMEAYADSHALTEVYP
FT                   GVVDTLKWLKRNGVEMALITNKPERFVAPLLDEMKLGRYFRWIIGGDTLPQQKPDPAAL
FT                   LFVMKMAGIEPEDALFVGDSRNDVLAAKAAGVRCAALTYGYNHGRPIAEEAPTLVIDNL
FT                   RDLLPCADQAAEIVLPDDSLSPSDQRDQAVAVSKLWMKVIKALARWRWRA"
FT   gene            683802..685280
FT                   /gene="trpE"
FT                   /locus_tag="PA14_07940"
FT   CDS_pept        683802..685280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="PA14_07940"
FT                   /product="anthranilate synthetase component I"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15573"
FT                   /db_xref="GOA:A0A0H2ZLM7"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLM7"
FT                   /protein_id="ABJ15573.1"
FT                   /translation="MNREEFLRLAADGYNRIPLSFETLADFDTPLSIYLKLADAPNSYL
FT                   LESVQGGEKWGRYSIIGLPCRTVLRVYDHQVRISIDGMETERFDCADPLAFVEEFKARY
FT                   QVPTVPGLPRFDGGLVGYFGYDCVRYVEKRLATCPNPDPLGNPDILLMVSDAVVVFDNL
FT                   AGKIHAIVLADPSEENAYERGQARLEELLERLRQPITPRRGLDLEAAQGREPAFRASFT
FT                   REDYENAVGRIKDYILAGDCMQVVPSQRMSIEFKAAPIDLYRALRCFNPTPYMYFFNFG
FT                   DFHVVGSSPEVLVRVEDGLVTVRPIAGTRPRGINEEADLALEQDLLSDAKEIAEHLMLI
FT                   DLGRNDVGRVSDIGAVKVTEKMVIERYSNVMHIVSNVTGQLREGLSAMDALRAILPAGT
FT                   LSGAPKIRAMEIIDELEPVKRGVYGGAVGYLAWNGNMDTAIAIRTAVIKNGELHVQAGG
FT                   GIVADSVPALEWEETINKRRAMFRAVALAEQSVE"
FT   gene            complement(685467..685781)
FT                   /gene="prtN"
FT                   /locus_tag="PA14_07950"
FT   CDS_pept        complement(685467..685781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtN"
FT                   /locus_tag="PA14_07950"
FT                   /product="transcriptional regulator PrtN"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15574"
FT                   /db_xref="GOA:A0A0H2ZLC7"
FT                   /db_xref="InterPro:IPR020518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC7"
FT                   /protein_id="ABJ15574.1"
FT                   /translation="MQPTIAPSTPIPRQETVELVYRIFGDVLVPLEQVRERWFRNLNKE
FT                   NFSKALACGRIALPVTTLDDSHKAMQFVALDHLAAYVDQRANQAGSARRAQPGADSIAS
FT                   "
FT   gene            complement(685881..686651)
FT                   /gene="prtR"
FT                   /locus_tag="PA14_07960"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0611"
FT   CDS_pept        complement(685881..686651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtR"
FT                   /locus_tag="PA14_07960"
FT                   /product="transcriptional regulator PrtR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15575"
FT                   /db_xref="GOA:A0A0H2ZLU5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLU5"
FT                   /protein_id="ABJ15575.1"
FT                   /translation="MDKSTQIPPDSFAARLKQAMAMRNLKQETLAEAAGVSQNTIHKLT
FT                   SGKAQSTRKLIEIAAALGVSPVWLQTGEGTPAARSAVSVADGSPLVLEPLHPWDSDTPL
FT                   DEDEVELPLYKEVEMSAGAGRTAVREIEGRKLRFSYATLRASGVDPSAAICAQLTGNSM
FT                   EPLIMDGSTIGVDTATTHITDGEIYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDE
FT                   EYSPEDMRSRQISMIGWVFWWSTVRHRRGPSLVR"
FT   gene            687109..687309
FT                   /locus_tag="PA14_07970"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0612"
FT   CDS_pept        687109..687309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07970"
FT                   /product="putative zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15576"
FT                   /db_xref="GOA:A0A0H2ZKZ3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012783"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ3"
FT                   /protein_id="ABJ15576.1"
FT                   /translation="MADLADHANELVLARLDGLLAARPALAIRESAEDCEDCGEPIPQA
FT                   RRRAAPGCSRCIDCQDRHERR"
FT   gene            687357..687716
FT                   /locus_tag="PA14_07980"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0613"
FT   CDS_pept        687357..687716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL1"
FT                   /protein_id="ABJ15577.1"
FT                   /translation="MIKAIDEMLKLWAEEMHAPGSNGGGYAGGNLIAMLIASKGEVVRG
FT                   HRGSRVILDRVAEVDRLVNRLPEELKNVVVEHYLNRDSFPEQKYRHCGCSRNTFYLRLH
FT                   VAHQGIQDGLLRRVA"
FT   gene            688080..688529
FT                   /gene="hol"
FT                   /locus_tag="PA14_07990"
FT   CDS_pept        688080..688529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hol"
FT                   /locus_tag="PA14_07990"
FT                   /product="putative holin"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15578"
FT                   /db_xref="GOA:A0A0H2ZLN2"
FT                   /db_xref="InterPro:IPR032128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLN2"
FT                   /protein_id="ABJ15578.1"
FT                   /translation="MKHRNPALAPGFLLPGKTFVRTCPALPAKEGPMGNEPQTLTEMPL
FT                   WVLILLAALGGVSGEMWRADKAGLGGWALLRRLALRSGASIVCGVAVMLLALACGAALL
FT                   FAAALGSLTAAAGAEIAVGLYERWAARRLGVCELPEEQSGDRGPH"
FT   gene            688551..689066
FT                   /locus_tag="PA14_08000"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0615"
FT   CDS_pept        688551..689066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15579"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD2"
FT                   /protein_id="ABJ15579.1"
FT                   /translation="MPEQAVTLEALYAAIEQVLRERLPEAQLIGFWPGVPENTPAVSLE
FT                   IAELLPERDPGTGESALLCRLQARIMVPPGADRQAVSIACGIVRTLREQTWNLSLEPAR
FT                   FVRSAVDGSREELKSLRVWLVEWTQSLRLGDPEWAWEDQPPGSLMLGFDPQTGPGHEPD
FT                   YFAPEALA"
FT   gene            689063..689620
FT                   /gene="gpV"
FT                   /locus_tag="PA14_08010"
FT   CDS_pept        689063..689620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpV"
FT                   /locus_tag="PA14_08010"
FT                   /product="putative baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15580"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLV0"
FT                   /protein_id="ABJ15580.1"
FT                   /translation="MSYVSAEHDRMLAAMILPCVVVAVDLAAARVRVRSGDWTSGWLRW
FT                   HSLAAGKVRHWRAPSIGEQGVLLSPSGGVSMGTFIPGLYGDAGTAPDNSASSETWRFDD
FT                   GASLSYDWAAHRYRVELPSGTVEVRVGASEVRVSDGAVSLKAPKISLEGPVEIAGTLTV
FT                   SGDILGGGSIIDTAGNSNHHTH"
FT   gene            689773..690099
FT                   /gene="gpW"
FT                   /locus_tag="PA14_08020"
FT   CDS_pept        689773..690099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpW"
FT                   /locus_tag="PA14_08020"
FT                   /product="putative baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15581"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ9"
FT                   /protein_id="ABJ15581.1"
FT                   /translation="MIGMDRRSGLPLSGLAHLKQSVEDILTTPLGSRRMRPEYGSKLRR
FT                   MVDMPVSEGWKSAVQAEVARSLGRWEPRIALSAVRVVAVVDGRVDLLLSGVFEGENINM
FT                   EVSA"
FT   gene            690096..690983
FT                   /locus_tag="PA14_08030"
FT   CDS_pept        690096..690983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08030"
FT                   /product="putative phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15582"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL5"
FT                   /protein_id="ABJ15582.1"
FT                   /translation="MIIDLSQLPEPEVIENLDFETIYQELLGDFREAMAGEWTAEVESD
FT                   PVLKLLQLAAYRELLLRARINDAARAVMLAYASGADLDQIGAGFNVQRLLIRPAQPEAV
FT                   PPVEAQYESDKSLRNRIQLAFEQLSVAGPRNAYIAHALGADGRVADASATSPAPCEVLI
FT                   SVLGVEGNGQAPEAVLQAVRLALNAEDVRPVADRVTVRSAGIVPYQVKAQLYLFPGPEA
FT                   ELIRAAAEASLRDYISAQRRLGRDIRRSALFATLHVEGVQRVELQEPAADVVLDETQAA
FT                   YCTGYAITLGGVDE"
FT   gene            690976..691509
FT                   /gene="gpI"
FT                   /locus_tag="PA14_08040"
FT   CDS_pept        690976..691509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpI"
FT                   /locus_tag="PA14_08040"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15583"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLN8"
FT                   /protein_id="ABJ15583.1"
FT                   /translation="MSSRLLPPNRSSLERSLGDVLPAELPVPLRELNDPARCEAALLPY
FT                   LAWTRSVDRWDPDWSDEAKRNAVATSFVLHQRKGTLTALRQVVEPIGALSEVTEWWQRS
FT                   PTGVPGTFEITVDVSDRGIDEGTVLELERLLDDVRPVSRHLTRLDLRITPVIRSRHGLA
FT                   VTDGDTLEIFPWKQ"
FT   gene            691511..693586
FT                   /locus_tag="PA14_08050"
FT                   /note="corresponds to Pseudomonas aeruginosa strain PAO1
FT                   locus PA0620"
FT   CDS_pept        691511..693586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08050"
FT                   /product="putative tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15584"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD7"
FT                   /protein_id="ABJ15584.1"
FT                   /translation="MTTNTPKYGGLLTDIGAAALAAASAAGKKWQPTHMLIGDAGGAPG
FT                   DTPDPLPSVAQKSLINQRHRAQLNRLFVSDKNANTLVAEVVLPVEVGGFWIREIGLQDA
FT                   DGKFVAVSNCPPSYKAAMESGSARTQTIRVNIALSGLENVQLLIDNGIIYATQDWVKEK
FT                   VAADFKGRKILAGNGLVGGGDLSADRSIGLAPSGVTAGSYRSVTVNANGVVTQGSNPTT
FT                   LAGYAIGDAYTKADTDGKLAQKANKATTLAGYGITDALRVDGNAVSSSRLAAPRSLAAS
FT                   GDASWSVTFDGSANVSAPLSLSATGVAAGSYPKVTVDTKGRVTAGMTLAATDIPGLDAS
FT                   KLVSGVLAEQRLPVFARGLATAVSNSSDPNTATVPLMLTNHANGP