(data stored in ACNUC7421 zone)

EMBL: CP000438.ACCC

CP000438.ACCC        Location/Qualifiers
FT   CDS_pept        565793..567169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="PA14_06450"
FT                   /product="putative acyl-CoA carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15459"
FT                   /db_xref="GOA:A0A0H2ZL34"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL34"
FT                   /protein_id="ABJ15459.1"
FT                   /translation="MHKRLNKLLVANRGEIAVRIIRAAQALGIPTVAVCSEADRDSLAA
FT                   RLADEVRLIGPARAERSYLDIEAILMAARETGADSIHPGYGFLSENPAFAEAVQAAGLV
FT                   FVGPDAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELDDLDAALACAEEVGYPLLVKAS
FT                   AGGGGRGIRIAHDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILGDGER
FT                   AVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTLEYLFD
FT                   AHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEDIRLNGAALEM
FT                   RINAEDPARNFFPSPGTVERLEWPQGEGVRVDSHLYPGYRVPPYYDSLLAKLIVHGRDR
FT                   DEAFARARQALERTVLAGMATTLPLHRWLLADARVQAAQFDTATLETWLAERTAAAQEV
FT                   "
     atgcacaagc gactgaacaa gctgctggtg gccaatcgcg gcgagatcgc cgtgcgcatc        60
     atccgcgccg cgcaggcact gggcattccc acggtagcgg tgtgcagcga ggcggatcgc       120
     gattcgctgg ccgcgcggct ggccgatgag gtacgtctga tcggccctgc gcgggccgag       180
     cggagctacc tggatattga ggcgattctc atggcggcgc gggaaaccgg tgccgactcg       240
     atccatcccg gctacggttt cctctccgag aaccctgcct tcgccgaagc ggtgcaggcg       300
     gccggactgg tcttcgtcgg tccggatgcg cagaccatcc gccgcatggg cgacaaggcc       360
     gaggcgcggc gtaccgcgat ggccgccggg gtgccggtgg tgccgggctc gcccggcgag       420
     ctggacgacc tcgacgcggc gctggcctgc gccgaagagg tcggctatcc gctgctggtc       480
     aaggcctccg ctggcggcgg cgggcgtggc atccgtatcg cccacgacgc cgacgaactg       540
     cgtcgggaat tccccatcgc ccagcgcgag gcgcaggccg ccttcggttc gccggcggtg       600
     tacctggagc gcttcatccg ccaggcgcgg cacatcgaag tgcagatcct cggcgatggc       660
     gagcgcgcgg tgcatctgtt cgaacgcgaa tgctcgctgc agcggcggcg ccagaaggtc       720
     ttcgaggagg caccttcggc ggcgctggac ggcgcgcagc gccaggccct ctgcgagagc       780
     gcggtgcgcc tggcgcagag tctcggctat cgtggcgcgg gcaccctgga atacctgttc       840
     gacgcgcaca gcggcgagtt cttcttcatc gagatgaaca cccgtatcca ggtcgagcat       900
     ccggtcagcg agatggtcac cggcatcgac ctggtccagg ccatgctgcg catcgccgcc       960
     ggcgaggcgc tgccctggcg ccaggaggac attcgcctga acggcgcggc gctggagatg      1020
     cggatcaacg ccgaagaccc ggcgcgcaat ttcttcccca gccccggcac cgtggagcgc      1080
     ctggaatggc cgcagggcga gggcgtgcga gtggacagcc acctgtatcc cggctaccgg      1140
     gtgccgccgt actacgattc gttgctggcc aagctgatcg tccatggtcg cgaccgcgac      1200
     gaagcgttcg cccgcgcgcg ccaggcgctg gagcgcaccg tgctggccgg catggccact      1260
     accctgccgc tgcaccgctg gctgctcgcc gatgcgcggg tacaggccgc gcagttcgat      1320
     accgctaccc tggaaacctg gctcgccgag cggaccgccg ccgcgcagga ggtttga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page