(data stored in ACNUC7421 zone)

EMBL: CP000438.AHPC

CP000438.AHPC        Location/Qualifiers
FT   CDS_pept        156164..156727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PA14_01710"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15095"
FT                   /db_xref="GOA:Q02UU0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UU0"
FT                   /protein_id="ABJ15095.1"
FT                   /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTF
FT                   NCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPG
FT                   EVCPAKWKEGEKTLAPSLDLVGKI"
     atgtccctga tcaacactca agtccaaccg ttcaaggtca acgctttcca caacggcaag        60
     ttcatcgagg tgaccgagga atccctgaag ggcaagtggt cggtcctgat cttcatgccg       120
     gctgccttca ccttcaactg cccgaccgag atcgaagacg ccgccaacaa ctacggcgag       180
     ttccagaaag ccggtgccga ggtctacatc gtgaccaccg acacccactt ctcgcacaag       240
     gtctggcacg aaacctcccc ggccgtcggc aaggcccagt tcccgctgat cggcgacccg       300
     acccaccagc tgaccaacgc cttcggcgtg cacatcccgg aagaaggcct ggccctgcgc       360
     ggtaccttcg tgatcaaccc ggaaggcgtg atcaagaccg tcgagatcca ctccaacgag       420
     atcgcccgtg acgtcggcga gaccgtgcgc aagctgaagg ccgcccagta caccgccgcc       480
     cacccgggcg aagtctgccc ggccaagtgg aaggaaggcg agaagaccct cgctccgtcc       540
     ctggacctgg tcggcaagat ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page