(data stored in ACNUC7421 zone)

EMBL: CP000438.AHPF

CP000438.AHPF        Location/Qualifiers
FT   CDS_pept        156872..158437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PA14_01720"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15096"
FT                   /db_xref="GOA:A0A0H2ZK64"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK64"
FT                   /protein_id="ABJ15096.1"
FT                   /translation="MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVG
FT                   LTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLD
FT                   ADVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETDGPKLARALEEHVRHYEV
FT                   DIMNLQRASKLVPAKNTGELHEVQFESGGSLKAKTLILATGARWREMGVPGEQEYKAKG
FT                   VCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKL
FT                   YSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLK
FT                   GSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRT
FT                   SAPE"
     atgttggacg ccaatcttaa aacccagttg aaggcctacc tggaaaaggt cagccagccg        60
     ttcgagatcg tcgcgtccct cgatgacagc gacaaatccc gcgagctgct gggcctgctg       120
     caagacatcg tcggcctgac cgacaagatc accctgaaga ccgacggcag cgatgcgcgc       180
     aaaccgtcgt tctcgctgaa ccgccccggt gcggacatcg gcctgcgctt cgccggtatc       240
     cccatgggcc acgaattcac ctcgctggtg ctggccctgc tgcaggtagg cggccacccc       300
     tccaagctcg acgcggacgt gatcgagcag gtcaagggca tcgagggcac cttcgagttc       360
     gaaacctact tctcgctgtc ctgccagaac tgcccggacg tggtccaggc gctgaacctg       420
     atggccgtgc tcaacccgaa catccgtcac gtcgccatcg acggcgcgct gttccaggat       480
     gaggtcgagg cgcgccagat catgtcggtg ccgagcatct acctcaacgg cgaagtcttc       540
     ggccagggcc gcatgggcgt ggaagagatc ctcgccaaga tcgacaccgg cgccgccgcc       600
     cgcgacgccg agaagctgac cgcccgcgac gccttcgacg tactggtggt cggcggtggt       660
     ccggccggcg ccgcggcggc gatctacgcc gcgcgcaagg gcattcgcac cggcgtcgcc       720
     gccgagcgct tcggcggcca ggtgctggac accatggcca tcgagaactt catctcggtg       780
     caggagaccg acgggccgaa gctggcgcgg gcgctggaag agcacgtgcg tcactacgag       840
     gtcgacatca tgaacctgca gcgcgccagc aagctggttc cggcgaagaa caccggcgag       900
     ttgcacgagg tgcagttcga gagcggcggc agcctcaagg ccaagaccct gatcctcgcc       960
     accggcgctc gctggcgcga aatgggcgtg cccggcgagc aggaatacaa ggccaagggc      1020
     gtgtgcttct gcccgcactg cgacggcccg ctgttcaagg gcaagcgcgt ggcggtgatc      1080
     ggcggcggca actctggcgt cgaggcggcc atcgacctgg ccggcatcgt cgcccatgtg      1140
     accctgctgg aattcgacag caagttgcgc gccgatgccg tgctgcaacg caagctctac      1200
     agcctgccga acgtcgaggt gatcaccagt gccctgacca gcgaagtgaa gggcgacggc      1260
     cagaaggtca ccggcctggt gtacaaggac cgcaactccg aggagttcaa gtcgatcgag      1320
     ctggaaggca tcttcgtgca gatcggcctg ctgcccaaca ccgagtggct caagggcagc      1380
     gtcgagctgt cgccgcgtgg cgagatcatc gtcgacgccc gtggcgagac ctcgctgccc      1440
     ggcatcttcg ccgccggcga cgtgaccacg gtgccgtaca agcagatcgt gatcgccgtg      1500
     ggcgagggcg ccaaggcttc gctgagcgcc ttcgaccacc tgatccggac ctccgcgccg      1560
     gagtga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page