(data stored in ACNUC7421 zone)

EMBL: CP000438.APAG

CP000438.APAG        Location/Qualifiers
FT   CDS_pept        complement(662979..663359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="PA14_07710"
FT                   /product="putative apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15555"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH2"
FT                   /protein_id="ABJ15555.1"
FT                   /translation="MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQ
FT                   LLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLG
FT                   SDGIAFDAAIPVFRLAVPGALH"
     atgagcgata cccagcacca ggtcaacgtc agggtcgaca cccgctacct tccggaacag        60
     tccgccccgg agcagaaccg tttcgccttc gcctacactg tgaccatcga gaaccagggc       120
     gaggttccgg cccaactgct gtcgcgccac tggatcatca ccgacggcga cggccgtacc       180
     caggaagttc gcggcgccgg cgtggtcggc gagcaaccgc tgatcgcccc cggcgcgcaa       240
     cacacctaca ccagcggcac ggtgctggcg acccgggtcg gcagcatgcg cggcagctac       300
     cagatgctcg gcagcgacgg aatcgccttc gacgccgcga tcccggtgtt tcgcctggcc       360
     gtaccgggag cgctgcactg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page