(data stored in ACNUC7421 zone)

EMBL: CP000438.ATSR

CP000438.ATSR        Location/Qualifiers
FT   CDS_pept        211201..212262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsR"
FT                   /locus_tag="PA14_02360"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15143"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA9"
FT                   /protein_id="ABJ15143.1"
FT                   /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVSA
FT                   GSSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLGDL
FT                   AAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLSFDN
FT                   ALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLSTRDLN
FT                   GAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQASYPVV
FT                   ILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRREFSAEQWAAPELLEAAG
FT                   KLAKAKAVAQAAE"
     atgaaagcgc ttacgtcttc cctgctcggt ctgttcgccg cgcctgtcct cgccggcctg        60
     ctcggtgcct acgtgccgct ggcgagcgcc gctccgccga aggaaatccg catcgcggtg       120
     ccggacgtca gcgccggcag ttcgcactcg ggcggcggcg tggtcgacgt gctctacacc       180
     cggcagttgc tggagaagga gttcgccaac gacggcatcg cggtgaaatg gagcttcttc       240
     aagggcgccg gtccggtggt caacgaagcg ttcgccaacg gccaggtgga cttcgcctac       300
     ctcggcgacc tggcggcgat catcggcaag tccggaggcc tggacagccg cctgctggcc       360
     gctaccgcgc gaggggtcaa ccactatctc ggcgtgcagc cgggctccgg gatcaagacc       420
     ctggaggatc tcaagggcaa gcgcgtaggc atcttccgcg gcaccgccag ccagttgtcg       480
     ttcgacaatg ccctggccag cgttggtctc agcgagaagg acctgaaggt gatcaacctc       540
     gatttcagcg ccgccctgtc cgccctcgca gccaggcaga tcgatgccac ctggggcctg       600
     gccggactgt tcgccctgcg cgaccgcggg ctcgcggaaa ttccgctgag cacccgcgac       660
     ttgaacggcg ccggcaccct gcaggcgctg ctggtcggct ccggggcttt cgtcgatgcc       720
     catccggaca tcaccgagcg gctgctcaag gtgcagttgc aggcccagga ctggctggcc       780
     cgcgaggaga accgcgacgc ctacatcgaa ctggtgtcga agcaggccag ctacccggtg       840
     gtgatcctgc agagcgagta ccgtggccgc aagctgggcg acgccctgtc gccgcgcctg       900
     gacgccgatt tccttggccg gctggatgct tcgatccagg cggccaagcg tttcggcctg       960
     atccgtcgcg aattcagcgc cgagcagtgg gccgcgccgg aactgctgga ggcggccggc      1020
     aagctggcga aggccaaggc cgtggcgcag gcggcggagt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page