(data stored in ACNUC7421 zone)

EMBL: CP000438.BFRG

CP000438.BFRG        Location/Qualifiers
FT   CDS_pept        499715..501907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfrG"
FT                   /locus_tag="PA14_05640"
FT                   /product="putative outer membrane ferric siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15401"
FT                   /db_xref="GOA:A0A0H2ZK72"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK72"
FT                   /protein_id="ABJ15401.1"
FT                   /translation="MKKHSTARRVLALGLNLTLAGVPAWLWADEEPTELPALTVSAGAA
FT                   GETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVNAS
FT                   APPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLNGAG
FT                   AVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRLDVSRS
FT                   GGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPYAGELK
FT                   IDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRNLETYRY
FT                   NADNSGVVRSNAFLQRHDQQLNGNRFELQHSQPLFGLASDWALGFDYSINKQTRFPSTA
FT                   SGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDELSLVTGLR
FT                   YDHLDLDVRNHRTVTASDPAHFERRWDVLTGRAGLVYQFTPHANVYLQYSTAADPPGGV
FT                   LTSASFGQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSVADPNNPNLSV
FT                   PVGQQTSRGIEAAASLRITPKLLAEGNFAWVDAQYDEFTENVGGVAVSRKGKTPPNVPE
FT                   RVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFLSYRLDERTRITG
FT                   RVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
     atgaaaaagc attccacggc ccgccgcgtc ctcgcgctgg gtctcaacct caccctggcc        60
     ggcgttccgg cctggctctg ggccgatgag gaacccaccg aactgcccgc cctcaccgtc       120
     agcgccggcg ccgccgggga aaccccgccg gccctcgatc tcgacgacag cgccggcggc       180
     ggctcgcgcc tgggcctgag cctgcgcgag actcccggct cggtaagcgt ggccaaccgt       240
     gccagcttcg agcggcgcgg cctgcgcagc acccaggaca tcgccaacag cctgcccggc       300
     gtgaacgcct cggcgccgcc cggcttcggc ggcttcgtca cctaccgcgg cttcagctcg       360
     aaccaggtca accagttgtt caacggcatt ccggtgcaat acagcagcgc catgcgtccg       420
     ctggacgact ggatcgtcga ccgcgtcgag ctggtcggcg gtccgtcctc cttcctcaac       480
     ggcgccggtg ccgtcggcgg ctcgctggac tacatcagca agctcgccga ccgctacggc       540
     gatttcatgg aaggccgggt gcgctatggc agctacgacg attcggaagt cgccttcggc       600
     ttcaaccagg ccctgggcat cggccccgag ccgaagcact tcgtgcgcct ggacgtcagc       660
     cgcagcggcg gcaacggcta cgtcgaccgc aattcgcgcg aatcgtggaa cgtcgctttc       720
     tccctgctca gcgacctgac cccggacctt tcccacaccc tggccctgga gtaccaggac       780
     gagcaggaag acagccccta ctggggcaca ccggtgctca atccctacgc cggcgagctg       840
     aagatcgaca agagccgtcg ccgcgagaac tacaacgtcg ccgatggccg ctacgaacag       900
     cgcgtgcgct ggctgcgctc gatcctcgaa taccgggtca gcgacagcac gcgctggcgc       960
     aacaccttct accactacga cgccgagcgc gattaccgca acctcgagac ctaccgctac      1020
     aacgccgaca acagcggggt ggtgcgctcc aacgcattcc tccagcgcca cgaccagcag      1080
     ctcaacggca accgcttcga gctacagcac agccagccgc tgttcggact ggccagcgac      1140
     tgggcgctgg gtttcgacta cagcatcaac aagcagacgc gcttcccgag taccgcctcc      1200
     gggccgttcg gtacggtcga tccggccagt ttcgagccgg gccacttcta cgacctgccg      1260
     ggcatgcgtc ccggccaccg gaaggaccgc agcaacgagg tgcgcaccag cgcgttgttc      1320
     gccgagaacc gcctgggcct gaccgacgag ctgtcgctgg tcaccgggct gcgctacgac      1380
     cacctcgacc tcgacgtgcg caaccatcgg acggtgaccg ccagcgatcc tgcacacttc      1440
     gaacggcgct gggacgtact caccgggcgc gccgggctgg tctaccagtt caccccgcac      1500
     gccaacgtct acctgcaata cagtaccgcc gccgacccgc cgggcggggt gctgaccagc      1560
     gccagcttcg gccaggtccg cgactacgac ctgtccaccg gcgaccagtg ggagctgggc      1620
     agcaagttcg atttcctcga cggtcgcggc agcgccaccc tggccgccta ccgcatcgtc      1680
     cgccgggact tctcggtggc cgacccgaac aaccccaacc tcagcgtgcc ggtgggccag      1740
     cagacctcca ggggcatcga ggccgccgcc tccctgcgga tcaccccgaa gctgctggcc      1800
     gagggcaatt tcgcctgggt cgacgcgcag tacgacgagt tcaccgagaa cgtcggcggc      1860
     gtcgccgtct cgcgcaaggg caagacgccg ccgaacgtgc cggagcgggt cggcaacctg      1920
     tggctgacct acgacttcga cccggcctgg cagggcgggg tggacgcgcg ctacgtgtcc      1980
     tcggtgtacg ccaacaacgc caacacctgg cacgtgccgt cctatacggt ctacgggact      2040
     ttcctcagct accggctgga cgagcgcacg cggatcaccg ggcgcgtgcg caacctcacc      2100
     gacgaggtct acgcgcgctt cgtgcagagc acgccgctgt actacgtcgg cgacccgcgc      2160
     accttcgagc tgagcgtgca gacgcgcttc tga                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page