(data stored in ACNUC7421 zone)

EMBL: CP000438.BIOC

CP000438.BIOC        Location/Qualifiers
FT   CDS_pept        572694..573518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="PA14_06540"
FT                   /product="putative biotin synthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15465"
FT                   /db_xref="GOA:A0A0H2ZLC0"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC0"
FT                   /protein_id="ABJ15465.1"
FT                   /translation="MPDDSAPLLAPHGVAALPDKRRVAASFSRAAASYDAVAELQRGVG
FT                   ESLLSALPEGFSPRRWVDLGCGTGHFSRALERRFGAAEGLAVDIAEGMLRHARARGGAS
FT                   HFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCVGTL
FT                   GELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLTLRHEDRVLHFPDLRSLTHELK
FT                   ALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPEGLPATYRVVFGVLRKDS"
     atgcctgacg attccgcgcc gctgctggcg ccccatggcg ttgccgcgct gcccgacaag        60
     cgccgggtcg ccgcgtcgtt ttcccgcgcg gcggccagct acgacgcggt ggccgaactc       120
     cagcgcggcg tcggcgagag cctgctgtcg gcattgccgg aaggcttctc gccgcgccgc       180
     tgggtcgatc tcggctgcgg caccggtcat ttcagccggg ccctggaacg ccgctttggc       240
     gcggccgagg gcctggctgt ggacatcgcc gaaggcatgc tgcggcatgc ccgcgcgcgc       300
     ggcggcgcca gccatttcat cggcggcgac gccgagaggc tgccgttgcg cgacggcagt       360
     tgcgacctgc tgttctccag cctggccatc cagtggtgcg ccgacctccc ggcggtcctg       420
     gccgaggcgc ggcgggtcct gcggccgggc ggcgtgctgg cgttcagcag cctgtgcgtc       480
     ggtaccctgg gcgagttgcg cgacagttgg cgggtggtgg acggcttcgt ccacgtcaat       540
     cgcttccgcg ccttcgccga ctacctgcaa cacgcggccg gcagcggtct gctgccgctg       600
     accctgcgcc acgaggaccg ggtcctgcat ttccccgacc tgcgcagcct gacccacgaa       660
     ctcaaggcgc tgggcgcgca caacctcaac cccgggcggc ccgacggcct gaccgggcgc       720
     cagcgcatcc gcgcgctggt cgccgcctac gagcgtttcc gccagcccga ggggctgccc       780
     gctacctacc gcgtcgtctt cggcgtgctg cgcaaggatt cctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page