(data stored in ACNUC7421 zone)

EMBL: CP000438.BIOH

CP000438.BIOH        Location/Qualifiers
FT   CDS_pept        571979..572701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="PA14_06530"
FT                   /product="putative biotin biosynthesis protein bioH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15464"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD0"
FT                   /protein_id="ABJ15464.1"
FT                   /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDA
FT                   ADWLDELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVREDWPNA
FT                   MPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVAGLQ
FT                   LLGQLDTRAALENFRGPQLHLFAEADALVPVAAAEALLEWLPDVEVSTLAASHGLPLEC
FT                   PDEVASAILRFLREGDDA"
     atgcgtgacc acctgatcct gttgccgggc tggggcctgg gcagcgcacc gctggaaccg        60
     ctgcgcgacg cgctgcacga gcgcgagccg cacctgaacg tgttgatcga gccgctgccg       120
     tcgctggacg atgccgccga ctggctcgac gaactcgacg acaacctgcc gcgcgatagc       180
     tggctggccg gctggtcgct gggtggcatg ctcgccggcg aactggcggc gcgccgcggc       240
     gacgattgcc ggggcctgct gaccctggcc agcaatccgt gcttccgtgt gcgcgaggac       300
     tggccgaacg cgatgccggc ggaaaccttc gaggacttct tcgaggcttt cctgctcgaa       360
     ccgcacctga cccgcaagcg tttcacccta ctggtcagcc agggtgcgcg cgaccctcgg       420
     accctggcgc ggcaactgca ggtggcgctg ccgcagctgg agcgcgaggc gctggtcgcc       480
     ggcctgcagt tgctcggcca actggatacc cgggccgccc tggaaaactt ccgcgggccg       540
     caattgcatc tgttcgccga agccgatgcg ctggtgccgg tggccgccgc cgaggccctg       600
     ctcgagtggc tgccggacgt cgaggtctcg accctggcgg ccagccacgg cctgccgctg       660
     gaatgcccgg acgaggtggc cagcgcaatc ctgagattcc ttcgcgaggg tgacgatgcc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page