(data stored in ACNUC7421 zone)

EMBL: CP000438.CATI

CP000438.CATI        Location/Qualifiers
FT   CDS_pept        245632..246483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /locus_tag="PA14_02760"
FT                   /product="putative CoA transferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15175"
FT                   /db_xref="GOA:A0A0H2ZKE2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE2"
FT                   /protein_id="ABJ15175.1"
FT                   /translation="MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRKD
FT                   LTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPHPLEIEEHSH
FT                   ADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVI
FT                   HAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWALSAVC
FT                   LVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQAKLAEG
FT                   KR"
     atggctgaaa tcctctccct gcgcgaagcg gtgcgacgct tcgtccacga tggcgacagc        60
     gtcgccctcg aaggcttcac tcacctgatc ccgacggccg ccggccacga gttgatccgc       120
     cagggcagga aagacctgac gctgatccgc atgactcccg acctggtcta cgacctgctg       180
     atcggtgcag gctgcgcgaa gaagctggtg ttctcctggg gcggcaaccc cggtgtcggt       240
     tcgctgcacc gcctgcgcga cgcggtggag aagggctggc cgcacccgct ggagatcgag       300
     gaacacagcc acgccgacct cgccaacgcc tatgtcgccg gcgcctccgg gctgcccttc       360
     gcggtgctgc gcgcctacgc cggctccgac ctgccgaagg tcaacccgct gatccgcagc       420
     gtcacctgcc cgttcaccgg cgaagtgctg gcggcggtgc cctcggtgcg cccggacgtc       480
     agcgtgatcc acgcgcagaa ggccgaccgc aagggcaacg tgctgctctg gggcatcctc       540
     ggcgtgcaga aggaagcggc cctggcggcg aagcgctgca tcgtcaccgt cgaggagatc       600
     gtcgacgaac tggacgcccc gatgaacgcc tgcgtcctgc cgagctgggc gctcagcgcc       660
     gtgtgcctgg tgcccggcgg cgcgcatccg tcctatgccc acggctacta cgaacgcgac       720
     aaccgcttct accaggactg ggacccgatc gcccgcgacc gcgaaagctt taccgcgtgg       780
     atcgacgaat acatccgggg gaccgaggat ttcggcgcct tccaggccaa gctcgcggag       840
     ggcaagcgat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page