(data stored in ACNUC7421 zone)

EMBL: CP000438.CHED

CP000438.CHED        Location/Qualifiers
FT   CDS_pept        complement(196940..197542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="PA14_02190"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15131"
FT                   /db_xref="GOA:A0A0H2ZJB1"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJB1"
FT                   /protein_id="ABJ15131.1"
FT                   /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASGEDLVIVTVLG
FT                   SCVSVCLRDPLNGIAGMNHFMLPERGLGGDPASPSARYGSHAMELLINRMLALGANRER
FT                   LQAKVFGGGSVLRQISAAIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGR
FT                   VLVKSLVELKNDTVLQRERDYRRRIDRNADGGPIDLF"
     atgaatctcc aggcccggga aggcgcgccg ctgaaccgct actacgatcc gtacttcgcc        60
     tgcgatgcgg tgaagctgtt gcccggcgag tacttcgcca gcggcgaaga cctggtgatc       120
     gtcaccgtgc tcggctcctg cgtctcggtg tgcctgcgcg acccgctcaa cggcatcgcc       180
     gggatgaacc acttcatgct ccccgagcgc ggcctcggcg gcgacccggc ctcgccgtcg       240
     gcgcgctacg gcagccacgc catggaactg ctgatcaacc gcatgctggc cctcggcgcc       300
     aaccgcgagc gcctgcaggc caaggtcttc ggcggcggct cggtactgcg ccagatcagc       360
     gccgccatcg gccagcgcaa cgtcgagttc accctcgact acctggccac cgagcgtatc       420
     ccgctgctcg ccagcgacgt gctggaggcc ttcccgcgca agatctactt cttcccgcgc       480
     aatggccggg tcctggtgaa gtccctggtg gagctgaaga acgacaccgt gctgcagcgt       540
     gaacgcgact accgccgccg tatcgatcgc aacgcggacg gcggccccat cgacctgttc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page